BLASTX nr result
ID: Panax25_contig00022375
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022375 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252683.1 PREDICTED: EPIDERMAL PATTERNING FACTOR-like prote... 55 3e-07 >XP_017252683.1 PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 9 [Daucus carota subsp. sativus] Length = 110 Score = 55.5 bits (132), Expect = 3e-07 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +2 Query: 2 IWAAQVILGSRIQIVKPYPQRVYGISASETQELQESSKGWTHDNARRLMIGSVAP 166 I A Q+ G +VK +P+ V+ ISA+ +LQ K W H NARRLMIGSVAP Sbjct: 17 ICAPQITQGFSAHVVKLHPRNVHQISAAVENDLQVHGKEWIHSNARRLMIGSVAP 71