BLASTX nr result
ID: Panax25_contig00022318
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022318 (573 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219214.1 PREDICTED: serine/arginine-rich SC35-like splicin... 55 4e-06 >XP_017219214.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 isoform X2 [Daucus carota subsp. sativus] Length = 214 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 100 SEDWKEIGFDYIVKISSLEEFQVILILTLAR 192 SED EIGFDYI+KISSLEEFQVILILTLAR Sbjct: 5 SEDGNEIGFDYILKISSLEEFQVILILTLAR 35