BLASTX nr result
ID: Panax25_contig00022209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022209 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235014.1 PREDICTED: uncharacterized protein LOC108208912 i... 66 1e-09 KZN05860.1 hypothetical protein DCAR_006697 [Daucus carota subsp... 66 1e-09 >XP_017235014.1 PREDICTED: uncharacterized protein LOC108208912 isoform X1 [Daucus carota subsp. sativus] XP_017235016.1 PREDICTED: uncharacterized protein LOC108208912 isoform X2 [Daucus carota subsp. sativus] Length = 1178 Score = 65.9 bits (159), Expect = 1e-09 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = -3 Query: 179 MEVRVESPDRGGRVTGIAMDFPVTDDGAGLCSXXXXXXXXXXXLSETKAYSPSSVEEIE 3 MEV VESP++G V IAMDFPV DDG +CS LSE K+YSPSSVEEIE Sbjct: 1 MEVGVESPEKGASVNAIAMDFPVYDDGNTVCSPPMIPSRIRRRLSENKSYSPSSVEEIE 59 >KZN05860.1 hypothetical protein DCAR_006697 [Daucus carota subsp. sativus] Length = 1299 Score = 65.9 bits (159), Expect = 1e-09 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = -3 Query: 179 MEVRVESPDRGGRVTGIAMDFPVTDDGAGLCSXXXXXXXXXXXLSETKAYSPSSVEEIE 3 MEV VESP++G V IAMDFPV DDG +CS LSE K+YSPSSVEEIE Sbjct: 1 MEVGVESPEKGASVNAIAMDFPVYDDGNTVCSPPMIPSRIRRRLSENKSYSPSSVEEIE 59 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/57 (57%), Positives = 37/57 (64%) Frame = -3 Query: 173 VRVESPDRGGRVTGIAMDFPVTDDGAGLCSXXXXXXXXXXXLSETKAYSPSSVEEIE 3 V VESP++G V IAMDFPV DDG +CS LSE K+YSPSSVEEIE Sbjct: 114 VGVESPEKGASVNAIAMDFPVYDDGNTVCSPPMIPSRIRRRLSENKSYSPSSVEEIE 170