BLASTX nr result
ID: Panax25_contig00022186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022186 (823 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242760.1 PREDICTED: regulatory protein NPR1 [Daucus carota... 136 6e-33 KZN03207.1 UDP-glycosyltransferase [Daucus carota subsp. sativus] 136 1e-32 XP_010323608.1 PREDICTED: non-inducible immunity 1 isoform X1 [S... 126 1e-29 APT37021.1 NPR1 [Nicotiana tabacum] 127 1e-29 XP_016503804.1 PREDICTED: regulatory protein NPR1-like [Nicotian... 127 1e-29 XP_009606361.1 PREDICTED: BTB/POZ domain and ankyrin repeat-cont... 127 1e-29 XP_015082844.1 PREDICTED: regulatory protein NPR1 [Solanum penne... 126 2e-29 NP_001234558.2 non-inducible immunity 1 [Solanum lycopersicum] A... 126 2e-29 AAT57637.1 non-inducible immunity 1 [Solanum lycopersicum] 126 2e-29 NP_001312028.1 regulatory protein NPR1 [Capsicum annuum] ABG3830... 126 2e-29 AND76218.1 regulatory protein NPR1 [Calotropis procera] 126 2e-29 AJT59488.1 NPR1 protein [Solanum torvum] 125 3e-29 XP_019262553.1 PREDICTED: BTB/POZ domain and ankyrin repeat-cont... 125 3e-29 NP_001313196.1 regulatory protein NPR1-like [Nicotiana tabacum] ... 125 3e-29 XP_010696528.1 PREDICTED: BTB/POZ domain and ankyrin repeat-cont... 125 5e-29 KNA06459.1 hypothetical protein SOVF_180800 [Spinacia oleracea] 125 5e-29 XP_006357709.1 PREDICTED: regulatory protein NPR1 [Solanum tuber... 125 6e-29 AAM62410.1 NPR1 [Nicotiana tabacum] ACM89450.1 nonexpressor of P... 124 8e-29 EEF48081.1 Regulatory protein NPR1, putative [Ricinus communis] 124 1e-28 XP_015571779.1 PREDICTED: regulatory protein NPR1 isoform X3 [Ri... 124 1e-28 >XP_017242760.1 PREDICTED: regulatory protein NPR1 [Daucus carota subsp. sativus] Length = 584 Score = 136 bits (342), Expect = 6e-33 Identities = 67/77 (87%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALSKTVELG+RFFPRCSQVLDKIMDTDDLSQLA+L D+PDE ETK+QRY Sbjct: 477 KEEHLNRLRALSKTVELGRRFFPRCSQVLDKIMDTDDLSQLAYLRNDSPDERETKKQRYT 536 Query: 183 EIQELLSEAFSEDKEEF 233 EIQELL+EAFSEDK EF Sbjct: 537 EIQELLNEAFSEDKVEF 553 >KZN03207.1 UDP-glycosyltransferase [Daucus carota subsp. sativus] Length = 886 Score = 136 bits (342), Expect = 1e-32 Identities = 67/77 (87%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALSKTVELG+RFFPRCSQVLDKIMDTDDLSQLA+L D+PDE ETK+QRY Sbjct: 253 KEEHLNRLRALSKTVELGRRFFPRCSQVLDKIMDTDDLSQLAYLRNDSPDERETKKQRYT 312 Query: 183 EIQELLSEAFSEDKEEF 233 EIQELL+EAFSEDK EF Sbjct: 313 EIQELLNEAFSEDKVEF 329 >XP_010323608.1 PREDICTED: non-inducible immunity 1 isoform X1 [Solanum lycopersicum] Length = 511 Score = 126 bits (317), Expect = 1e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 409 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTVEERQLKKQRYM 468 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 469 ELQEILSKAFTEDKEEF 485 >APT37021.1 NPR1 [Nicotiana tabacum] Length = 588 Score = 127 bits (318), Expect = 1e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 545 ELQEILSKAFTEDKEEF 561 >XP_016503804.1 PREDICTED: regulatory protein NPR1-like [Nicotiana tabacum] Length = 588 Score = 127 bits (318), Expect = 1e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 545 ELQEILSKAFTEDKEEF 561 >XP_009606361.1 PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Nicotiana tomentosiformis] Length = 588 Score = 127 bits (318), Expect = 1e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 545 ELQEILSKAFTEDKEEF 561 >XP_015082844.1 PREDICTED: regulatory protein NPR1 [Solanum pennellii] Length = 576 Score = 126 bits (317), Expect = 2e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 474 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTVEERQLKKQRYM 533 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 534 ELQEILSKAFTEDKEEF 550 >NP_001234558.2 non-inducible immunity 1 [Solanum lycopersicum] APY24056.1 NPR1 [Solanum lycopersicum] Length = 576 Score = 126 bits (317), Expect = 2e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 474 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTVEERQLKKQRYM 533 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 534 ELQEILSKAFTEDKEEF 550 >AAT57637.1 non-inducible immunity 1 [Solanum lycopersicum] Length = 576 Score = 126 bits (317), Expect = 2e-29 Identities = 58/77 (75%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 474 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTVEERQLKKQRYM 533 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 534 ELQEILSKAFTEDKEEF 550 >NP_001312028.1 regulatory protein NPR1 [Capsicum annuum] ABG38308.1 NPR1 [Capsicum annuum] Length = 582 Score = 126 bits (317), Expect = 2e-29 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRL ALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DTP+E + K+QRYM Sbjct: 480 KEEHLNRLMALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTPEERQLKKQRYM 539 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+L++AF+EDKEEF Sbjct: 540 ELQEILTKAFTEDKEEF 556 >AND76218.1 regulatory protein NPR1 [Calotropis procera] Length = 586 Score = 126 bits (317), Expect = 2e-29 Identities = 56/77 (72%), Positives = 73/77 (94%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNR+RALS+TVELGKRFFPRCS+VL+KIMDTDDL+++A++G DTP+E + K+QRY+ Sbjct: 485 KEEHLNRMRALSRTVELGKRFFPRCSEVLNKIMDTDDLTEIAYMGSDTPEERQLKKQRYV 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+Q++L+ AFSEDKEEF Sbjct: 545 ELQQVLTRAFSEDKEEF 561 >AJT59488.1 NPR1 protein [Solanum torvum] Length = 580 Score = 125 bits (315), Expect = 3e-29 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 477 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 536 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDK+EF Sbjct: 537 ELQEILSKAFTEDKQEF 553 >XP_019262553.1 PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Nicotiana attenuata] OIT37731.1 regulatory protein npr1 [Nicotiana attenuata] Length = 588 Score = 125 bits (315), Expect = 3e-29 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+L++AF+EDKEEF Sbjct: 545 ELQEILTKAFTEDKEEF 561 >NP_001313196.1 regulatory protein NPR1-like [Nicotiana tabacum] XP_009802447.1 PREDICTED: regulatory protein NPR1 [Nicotiana sylvestris] ABH04326.1 NPR1 [Nicotiana tabacum] Length = 588 Score = 125 bits (315), Expect = 3e-29 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+L++AF+EDKEEF Sbjct: 545 ELQEILTKAFTEDKEEF 561 >XP_010696528.1 PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Beta vulgaris subsp. vulgaris] AAT57640.1 non-inducible immunity 1 [Beta vulgaris] ABH08432.1 putative non-inducible immunity 1 [Beta vulgaris] ABM55236.1 NPR1 [Beta vulgaris] KMS96842.1 hypothetical protein BVRB_8g199180 [Beta vulgaris subsp. vulgaris] Length = 604 Score = 125 bits (314), Expect = 5e-29 Identities = 58/77 (75%), Positives = 71/77 (92%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHL R++ALSKTVELGKRFFPRCS VL+KIMD +DLSQLAFLGKDTP+E + KR+RY+ Sbjct: 503 KEEHLQRMKALSKTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYL 562 Query: 183 EIQELLSEAFSEDKEEF 233 E+Q+ L++AF+EDKEEF Sbjct: 563 ELQDALTKAFTEDKEEF 579 >KNA06459.1 hypothetical protein SOVF_180800 [Spinacia oleracea] Length = 606 Score = 125 bits (314), Expect = 5e-29 Identities = 58/77 (75%), Positives = 71/77 (92%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHL R++ALS+TVELGKRFFPRCS VL+KIMD +DLSQLAFLGKDTP+E + KR+RY+ Sbjct: 505 KEEHLQRMKALSRTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYL 564 Query: 183 EIQELLSEAFSEDKEEF 233 E+Q+ L++AFSEDKEEF Sbjct: 565 ELQDALTKAFSEDKEEF 581 >XP_006357709.1 PREDICTED: regulatory protein NPR1 [Solanum tuberosum] Length = 579 Score = 125 bits (313), Expect = 6e-29 Identities = 58/77 (75%), Positives = 71/77 (92%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A +G DT +E + K+QRYM Sbjct: 477 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIACMGNDTAEERQLKKQRYM 536 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+LS+AF+EDKEEF Sbjct: 537 ELQEILSKAFTEDKEEF 553 >AAM62410.1 NPR1 [Nicotiana tabacum] ACM89450.1 nonexpressor of PR, partial [Nicotiana glutinosa] Length = 588 Score = 124 bits (312), Expect = 8e-29 Identities = 56/77 (72%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 KEEHLNRLRALS+TVELGKRFFPRCS+VL+KIMD DDLS++A++G DT +E + K+QRYM Sbjct: 485 KEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTAEERQLKKQRYM 544 Query: 183 EIQELLSEAFSEDKEEF 233 E+QE+L++AF+EDKEE+ Sbjct: 545 ELQEILTKAFTEDKEEY 561 >EEF48081.1 Regulatory protein NPR1, putative [Ricinus communis] Length = 589 Score = 124 bits (311), Expect = 1e-28 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 +EEHLNR++ALS+TVELGKRFFPRCS+VL++IMD DDLSQLA+LGKDT +E K+QRYM Sbjct: 483 QEEHLNRMKALSRTVELGKRFFPRCSEVLNRIMDADDLSQLAYLGKDTVEERHQKKQRYM 542 Query: 183 EIQELLSEAFSEDKEEF 233 E+Q+LLS+AF+EDK+EF Sbjct: 543 ELQDLLSKAFNEDKQEF 559 >XP_015571779.1 PREDICTED: regulatory protein NPR1 isoform X3 [Ricinus communis] Length = 597 Score = 124 bits (311), Expect = 1e-28 Identities = 57/77 (74%), Positives = 72/77 (93%) Frame = +3 Query: 3 KEEHLNRLRALSKTVELGKRFFPRCSQVLDKIMDTDDLSQLAFLGKDTPDEGETKRQRYM 182 +EEHLNR++ALS+TVELGKRFFPRCS+VL++IMD DDLSQLA+LGKDT +E K+QRYM Sbjct: 474 QEEHLNRMKALSRTVELGKRFFPRCSEVLNRIMDADDLSQLAYLGKDTVEERHQKKQRYM 533 Query: 183 EIQELLSEAFSEDKEEF 233 E+Q+LLS+AF+EDK+EF Sbjct: 534 ELQDLLSKAFNEDKQEF 550