BLASTX nr result
ID: Panax25_contig00022015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022015 (1222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAB61039.1 A_IG002N01.31 gene product [Arabidopsis thaliana] 62 9e-07 KOM52961.1 hypothetical protein LR48_Vigan09g162000 [Vigna angul... 60 3e-06 AII99858.1 chitinase [Cicer arietinum] 59 9e-06 >AAB61039.1 A_IG002N01.31 gene product [Arabidopsis thaliana] Length = 968 Score = 62.4 bits (150), Expect = 9e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +2 Query: 1100 AYITPCEGASLVLEGRHNADKGWISELRMKGEA-QVHSGMP 1219 AYITPC+G+ LVLEGRHNADKGWI ELR +G A G+P Sbjct: 131 AYITPCQGSGLVLEGRHNADKGWIQELRSRGNALSASKGLP 171 >KOM52961.1 hypothetical protein LR48_Vigan09g162000 [Vigna angularis] Length = 398 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 1103 YITPCEGASLVLEGRHNADKGWISELRMKGEAQV 1204 YITPC+ SLVLEGRHNAD+GWISELR GEA + Sbjct: 101 YITPCQQTSLVLEGRHNADRGWISELRKSGEALI 134 >AII99858.1 chitinase [Cicer arietinum] Length = 408 Score = 58.5 bits (140), Expect = 9e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 1103 YITPCEGASLVLEGRHNADKGWISELRMKGEAQV 1204 YITPC+ SLVLEGRHNAD+GWISEL+ GEA + Sbjct: 110 YITPCQQTSLVLEGRHNADRGWISELKKTGEALI 143