BLASTX nr result
ID: Panax25_contig00021462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021462 (526 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP13984.1 unnamed protein product [Coffea canephora] 66 2e-09 XP_016474599.1 PREDICTED: sorting and assembly machinery compone... 65 5e-09 XP_009589020.1 PREDICTED: sorting and assembly machinery compone... 65 5e-09 KVI04840.1 Bacterial surface antigen (D15) [Cynara cardunculus v... 64 6e-09 XP_010257075.1 PREDICTED: uncharacterized protein LOC104597307 [... 63 2e-08 XP_019262795.1 PREDICTED: sorting and assembly machinery compone... 62 3e-08 XP_016514344.1 PREDICTED: sorting and assembly machinery compone... 61 7e-08 XP_009801065.1 PREDICTED: sorting and assembly machinery compone... 61 7e-08 KZN03078.1 hypothetical protein DCAR_011834 [Daucus carota subsp... 59 6e-07 KVI09961.1 hypothetical protein Ccrd_011681 [Cynara cardunculus ... 59 6e-07 XP_017242952.1 PREDICTED: sorting and assembly machinery compone... 59 6e-07 XP_015073972.1 PREDICTED: sorting and assembly machinery compone... 59 6e-07 XP_019158282.1 PREDICTED: sorting and assembly machinery compone... 58 9e-07 XP_006354915.1 PREDICTED: sorting and assembly machinery compone... 58 9e-07 XP_004238178.1 PREDICTED: sorting and assembly machinery compone... 58 9e-07 XP_004140074.1 PREDICTED: sorting and assembly machinery compone... 57 2e-06 XP_016568735.1 PREDICTED: LOW QUALITY PROTEIN: sorting and assem... 57 3e-06 XP_019192420.1 PREDICTED: uncharacterized protein LOC109186755 [... 56 5e-06 XP_007218982.1 hypothetical protein PRUPE_ppa003969mg [Prunus pe... 56 5e-06 XP_008456518.1 PREDICTED: LOW QUALITY PROTEIN: sorting and assem... 55 7e-06 >CDP13984.1 unnamed protein product [Coffea canephora] Length = 469 Score = 65.9 bits (159), Expect = 2e-09 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+EALKTAT+VQELLQAA IANARL +R EIFDSVNITLD Sbjct: 30 DSLIEAEVEALKTATTVQELLQAAGIANARL-QRLEIFDSVNITLD 74 >XP_016474599.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Nicotiana tabacum] Length = 508 Score = 64.7 bits (156), Expect = 5e-09 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK AT+VQELL+AASIANARL ++F+IFDSVNITLD Sbjct: 91 ESLIEAEVEALKNATTVQELLKAASIANARL-QQFDIFDSVNITLD 135 >XP_009589020.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like, partial [Nicotiana tomentosiformis] Length = 518 Score = 64.7 bits (156), Expect = 5e-09 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK AT+VQELL+AASIANARL ++F+IFDSVNITLD Sbjct: 92 ESLIEAEVEALKNATTVQELLKAASIANARL-QQFDIFDSVNITLD 136 >KVI04840.1 Bacterial surface antigen (D15) [Cynara cardunculus var. scolymus] Length = 531 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK ATSVQELLQAA+IANARL ++ +IFDSVNITLD Sbjct: 93 ESLIEAEVEALKNATSVQELLQAATIANARL-QKLDIFDSVNITLD 137 >XP_010257075.1 PREDICTED: uncharacterized protein LOC104597307 [Nelumbo nucifera] Length = 532 Score = 62.8 bits (151), Expect = 2e-08 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+E LK ATS+QELLQAA+IANARL +R EIFDSVNITLD Sbjct: 93 DSLIEAEVEVLKNATSMQELLQAATIANARL-QRLEIFDSVNITLD 137 >XP_019262795.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Nicotiana attenuata] OIT37572.1 hypothetical protein A4A49_28757 [Nicotiana attenuata] Length = 529 Score = 62.4 bits (150), Expect = 3e-08 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK AT+VQELL+AASIANARL ++ +IFDSVNITLD Sbjct: 90 ESLIEAEVEALKNATTVQELLKAASIANARL-QQLDIFDSVNITLD 134 >XP_016514344.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Nicotiana tabacum] Length = 528 Score = 61.2 bits (147), Expect = 7e-08 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI E+EALK AT+VQELL+AASIANARL ++ +IFDSVNITLD Sbjct: 89 ESLIEVEVEALKNATTVQELLKAASIANARL-QQLDIFDSVNITLD 133 >XP_009801065.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Nicotiana sylvestris] Length = 528 Score = 61.2 bits (147), Expect = 7e-08 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI E+EALK AT+VQELL+AASIANARL ++ +IFDSVNITLD Sbjct: 89 ESLIEVEVEALKNATTVQELLKAASIANARL-QQLDIFDSVNITLD 133 >KZN03078.1 hypothetical protein DCAR_011834 [Daucus carota subsp. sativus] Length = 469 Score = 58.5 bits (140), Expect = 6e-07 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +EI++L+ A+SVQELL+AASIANARL +R +IF+SVNITLD Sbjct: 30 EALIEAEIQSLREASSVQELLKAASIANARL-QRLDIFESVNITLD 74 >KVI09961.1 hypothetical protein Ccrd_011681 [Cynara cardunculus var. scolymus] Length = 512 Score = 58.5 bits (140), Expect = 6e-07 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E++ALKT TS+QELLQAA+IANARL ++ IFDSV +TLD Sbjct: 73 ESLIEAEVQALKTVTSMQELLQAATIANARL-QKLAIFDSVTVTLD 117 >XP_017242952.1 PREDICTED: sorting and assembly machinery component 50 homolog B [Daucus carota subsp. sativus] Length = 513 Score = 58.5 bits (140), Expect = 6e-07 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +EI++L+ A+SVQELL+AASIANARL +R +IF+SVNITLD Sbjct: 75 EALIEAEIQSLREASSVQELLKAASIANARL-QRLDIFESVNITLD 119 >XP_015073972.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Solanum pennellii] Length = 525 Score = 58.5 bits (140), Expect = 6e-07 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK+AT++QELL+AASIANARL ++ +IFDSV ITLD Sbjct: 86 ESLIEAEMEALKSATTLQELLKAASIANARL-QQLDIFDSVKITLD 130 >XP_019158282.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Ipomoea nil] Length = 523 Score = 58.2 bits (139), Expect = 9e-07 Identities = 30/46 (65%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+E LK+AT++Q+LLQA+ +ANARL +R EIFDSVNITLD Sbjct: 85 DSLIEAEVEFLKSATTLQQLLQASGVANARL-QRLEIFDSVNITLD 129 >XP_006354915.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Solanum tuberosum] Length = 524 Score = 58.2 bits (139), Expect = 9e-07 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK AT++QELL+AASIANARL ++ +IFDSV ITLD Sbjct: 85 ESLIEAEMEALKNATTLQELLKAASIANARL-QQLDIFDSVKITLD 129 >XP_004238178.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Solanum lycopersicum] Length = 526 Score = 58.2 bits (139), Expect = 9e-07 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALK+AT++QELL+AASIANARL + +IFDSV ITLD Sbjct: 87 ESLIEAEMEALKSATTLQELLKAASIANARL-QHLDIFDSVKITLD 131 >XP_004140074.1 PREDICTED: sorting and assembly machinery component 50 homolog [Cucumis sativus] KGN47843.1 hypothetical protein Csa_6G406550 [Cucumis sativus] Length = 536 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+EA+KTA+++QELL+AA +ANA+L +R EIFDSV ITLD Sbjct: 98 DSLIEAEVEAIKTASTMQELLEAAGVANAKL-QRLEIFDSVKITLD 142 >XP_016568735.1 PREDICTED: LOW QUALITY PROTEIN: sorting and assembly machinery component 50 homolog B-like [Capsicum annuum] Length = 525 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/46 (65%), Positives = 41/46 (89%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+EALKTAT++Q+LL+AASIAN RL ++ +IF+SV+ITLD Sbjct: 84 ESLIEAELEALKTATTLQDLLKAASIANGRL-QQLDIFESVSITLD 128 >XP_019192420.1 PREDICTED: uncharacterized protein LOC109186755 [Ipomoea nil] Length = 519 Score = 55.8 bits (133), Expect = 5e-06 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+E LK+A++VQELLQAASIANARL ++ IFDSV ITLD Sbjct: 89 DSLIEAELEVLKSASTVQELLQAASIANARL-QQLGIFDSVKITLD 133 >XP_007218982.1 hypothetical protein PRUPE_ppa003969mg [Prunus persica] ONI24669.1 hypothetical protein PRUPE_2G254100 [Prunus persica] ONI24670.1 hypothetical protein PRUPE_2G254100 [Prunus persica] Length = 537 Score = 55.8 bits (133), Expect = 5e-06 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 E LI +E+E +K AT++QELL+AA IANA+L +R EIFDSV ITLD Sbjct: 99 EHLIEAELEGIKKATTMQELLEAAGIANAKL-QRLEIFDSVRITLD 143 >XP_008456518.1 PREDICTED: LOW QUALITY PROTEIN: sorting and assembly machinery component 50 homolog [Cucumis melo] Length = 536 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +1 Query: 1 EPLIVSEIEALKTATSVQELLQAASIANARLRRRFEIFDSVNITLD 138 + LI +E+EA+K A+++QELL+AA +ANA+L +R EIFDSV ITLD Sbjct: 98 DSLIEAEVEAIKNASTMQELLEAAGVANAKL-QRLEIFDSVKITLD 142