BLASTX nr result
ID: Panax25_contig00021317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021317 (533 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO75796.1 hypothetical protein CISIN_1g019268mg [Citrus sinensis] 51 5e-10 XP_010696587.1 PREDICTED: secretory carrier-associated membrane ... 54 6e-10 KRH49967.1 hypothetical protein GLYMA_07G191600 [Glycine max] 55 6e-10 XP_007043515.1 PREDICTED: secretory carrier-associated membrane ... 54 1e-09 EOX99347.1 Secretory carrier membrane protein (SCAMP) family pro... 54 1e-09 EOX99348.1 Secretory carrier membrane protein (SCAMP) family pro... 54 1e-09 XP_010278340.1 PREDICTED: secretory carrier-associated membrane ... 52 1e-09 XP_015880770.1 PREDICTED: secretory carrier-associated membrane ... 54 1e-09 XP_010268786.1 PREDICTED: secretory carrier-associated membrane ... 52 1e-09 XP_006432645.1 hypothetical protein CICLE_v10002151mg [Citrus cl... 51 1e-09 XP_016559938.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_012462078.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_012462079.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_016674832.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_012462081.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 KZV51970.1 secretory carrier-associated membrane protein 2 [Dorc... 53 2e-09 KJB79956.1 hypothetical protein B456_013G074400 [Gossypium raimo... 53 2e-09 XP_012462082.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_012462083.1 PREDICTED: secretory carrier-associated membrane ... 53 2e-09 XP_018843911.1 PREDICTED: secretory carrier-associated membrane ... 51 2e-09 >KDO75796.1 hypothetical protein CISIN_1g019268mg [Citrus sinensis] Length = 343 Score = 51.2 bits (121), Expect(2) = 5e-10 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ +HIGFCIFA+VAPP++FKGKSL Sbjct: 249 FFLFYLLHIGFCIFASVAPPIIFKGKSL 276 Score = 40.0 bits (92), Expect(2) = 5e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 185 CRTESALKFSWFFLFYLVSV 244 CRTESA+KF WFFLFYL+ + Sbjct: 238 CRTESAMKFGWFFLFYLLHI 257 >XP_010696587.1 PREDICTED: secretory carrier-associated membrane protein 3 [Beta vulgaris subsp. vulgaris] XP_019102739.1 PREDICTED: secretory carrier-associated membrane protein 3 [Beta vulgaris subsp. vulgaris] KMS96770.1 hypothetical protein BVRB_8g199530 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 54.3 bits (129), Expect(2) = 6e-10 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +H+GFCIFAAVAPP++FKGKSLA Sbjct: 215 FFLFYLIHVGFCIFAAVAPPIIFKGKSLA 243 Score = 36.6 bits (83), Expect(2) = 6e-10 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RTESAL F WFFLFYL+ V Sbjct: 205 RTESALNFGWFFLFYLIHV 223 >KRH49967.1 hypothetical protein GLYMA_07G191600 [Glycine max] Length = 234 Score = 55.5 bits (132), Expect(2) = 6e-10 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA*VF--YVEFLPC 410 FFL+ +HIGFCI AAVAPP+VFKGKSL V+ YV +L C Sbjct: 194 FFLFYLLHIGFCILAAVAPPIVFKGKSLTYVYFIYVLYLTC 234 Score = 35.4 bits (80), Expect(2) = 6e-10 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 R ESALKF WFFLFYL+ + Sbjct: 184 RNESALKFGWFFLFYLLHI 202 >XP_007043515.1 PREDICTED: secretory carrier-associated membrane protein 1 [Theobroma cacao] EOX99346.1 Secretory carrier-associated membrane protein 1 isoform 1 [Theobroma cacao] Length = 303 Score = 53.9 bits (128), Expect(2) = 1e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFAAVAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFAAVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >EOX99347.1 Secretory carrier membrane protein (SCAMP) family protein isoform 2 [Theobroma cacao] Length = 281 Score = 53.9 bits (128), Expect(2) = 1e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFAAVAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFAAVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >EOX99348.1 Secretory carrier membrane protein (SCAMP) family protein isoform 3 [Theobroma cacao] Length = 263 Score = 53.9 bits (128), Expect(2) = 1e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFAAVAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFAAVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >XP_010278340.1 PREDICTED: secretory carrier-associated membrane protein 3-like [Nelumbo nucifera] Length = 311 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ +HIGFCIFAAVAPP++FKGKSL Sbjct: 217 FFLFYLLHIGFCIFAAVAPPIIFKGKSL 244 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RTESALKF WFFLFYL+ + Sbjct: 207 RTESALKFGWFFLFYLLHI 225 >XP_015880770.1 PREDICTED: secretory carrier-associated membrane protein 1 [Ziziphus jujuba] Length = 304 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FF++ VHIGFCIFAAVAPP++FKGKSLA Sbjct: 210 FFMFYLVHIGFCIFAAVAPPIIFKGKSLA 238 Score = 35.4 bits (80), Expect(2) = 1e-09 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SAL+F WFF+FYLV + Sbjct: 200 RTDSALRFGWFFMFYLVHI 218 >XP_010268786.1 PREDICTED: secretory carrier-associated membrane protein 3-like [Nelumbo nucifera] Length = 288 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ VHIGFCIF+AVAPP++FKGKSL Sbjct: 194 FFLFYLVHIGFCIFSAVAPPIIFKGKSL 221 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYLV + Sbjct: 184 RTDSALKFGWFFLFYLVHI 202 >XP_006432645.1 hypothetical protein CICLE_v10002151mg [Citrus clementina] XP_006471452.1 PREDICTED: secretory carrier-associated membrane protein 4 [Citrus sinensis] ESR45885.1 hypothetical protein CICLE_v10002151mg [Citrus clementina] KDO58811.1 hypothetical protein CISIN_1g047188mg [Citrus sinensis] Length = 271 Score = 51.2 bits (121), Expect(2) = 1e-09 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ +HIGFCIFAA+APPVVF GKSL Sbjct: 193 FFLFYLIHIGFCIFAAIAPPVVFHGKSL 220 Score = 38.5 bits (88), Expect(2) = 1e-09 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKFSWFFLFYL+ + Sbjct: 183 RTDSALKFSWFFLFYLIHI 201 >XP_016559938.1 PREDICTED: secretory carrier-associated membrane protein 2-like [Capsicum annuum] Length = 311 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ VHIGFCIFAAVAPP+VF+GKSL Sbjct: 217 FFLFYLVHIGFCIFAAVAPPIVFRGKSL 244 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RTE A+KF+WFFLFYLV + Sbjct: 207 RTEGAMKFAWFFLFYLVHI 225 >XP_012462078.1 PREDICTED: secretory carrier-associated membrane protein 1 isoform X1 [Gossypium raimondii] Length = 309 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 215 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 243 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 205 RTDSALKFGWFFLFYLLHI 223 >XP_012462079.1 PREDICTED: secretory carrier-associated membrane protein 1 isoform X2 [Gossypium raimondii] Length = 304 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 210 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 238 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 200 RTDSALKFGWFFLFYLLHI 218 >XP_016674832.1 PREDICTED: secretory carrier-associated membrane protein 1-like [Gossypium hirsutum] XP_016704973.1 PREDICTED: secretory carrier-associated membrane protein 1-like [Gossypium hirsutum] XP_017620241.1 PREDICTED: secretory carrier-associated membrane protein 1-like [Gossypium arboreum] Length = 303 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >XP_012462081.1 PREDICTED: secretory carrier-associated membrane protein 1 isoform X3 [Gossypium raimondii] KJB79954.1 hypothetical protein B456_013G074400 [Gossypium raimondii] Length = 303 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >KZV51970.1 secretory carrier-associated membrane protein 2 [Dorcoceras hygrometricum] Length = 302 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ +HIGFCIFAAVAPP+VFKGKSL Sbjct: 208 FFLFYLLHIGFCIFAAVAPPIVFKGKSL 235 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RTESALKF WFFLFYL+ + Sbjct: 198 RTESALKFWWFFLFYLLHI 216 >KJB79956.1 hypothetical protein B456_013G074400 [Gossypium raimondii] Length = 279 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 209 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 237 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 199 RTDSALKFGWFFLFYLLHI 217 >XP_012462082.1 PREDICTED: secretory carrier-associated membrane protein 1 isoform X4 [Gossypium raimondii] Length = 275 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 181 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 209 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 171 RTDSALKFGWFFLFYLLHI 189 >XP_012462083.1 PREDICTED: secretory carrier-associated membrane protein 1 isoform X5 [Gossypium raimondii] KJB79953.1 hypothetical protein B456_013G074400 [Gossypium raimondii] Length = 269 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSLA 380 FFL+ +HIGFCIFA+VAPP++FKGKSLA Sbjct: 175 FFLFYLLHIGFCIFASVAPPIIFKGKSLA 203 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SALKF WFFLFYL+ + Sbjct: 165 RTDSALKFGWFFLFYLLHI 183 >XP_018843911.1 PREDICTED: secretory carrier-associated membrane protein 4 [Juglans regia] Length = 269 Score = 51.2 bits (121), Expect(2) = 2e-09 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 294 FFLWLQVHIGFCIFAAVAPPVVFKGKSL 377 FFL+ +HIGFCIFAA+APPVVF GKSL Sbjct: 193 FFLFYLIHIGFCIFAAIAPPVVFHGKSL 220 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = +2 Query: 188 RTESALKFSWFFLFYLVSV 244 RT+SA+KFSWFFLFYL+ + Sbjct: 183 RTDSAMKFSWFFLFYLIHI 201