BLASTX nr result
ID: Panax25_contig00021125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021125 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009788644.1 PREDICTED: guanine nucleotide-binding protein-lik... 69 3e-11 XP_016577496.1 PREDICTED: guanine nucleotide-binding protein-lik... 67 2e-10 XP_019264838.1 PREDICTED: guanine nucleotide-binding protein-lik... 66 3e-10 KZN03879.1 hypothetical protein DCAR_012635 [Daucus carota subsp... 65 7e-10 XP_017243061.1 PREDICTED: guanine nucleotide-binding protein-lik... 65 7e-10 XP_016435109.1 PREDICTED: guanine nucleotide-binding protein-lik... 65 1e-09 XP_009612778.1 PREDICTED: guanine nucleotide-binding protein-lik... 65 1e-09 XP_004242396.1 PREDICTED: guanine nucleotide-binding protein-lik... 65 1e-09 XP_006364266.1 PREDICTED: guanine nucleotide-binding protein-lik... 64 2e-09 XP_015166521.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotid... 63 3e-09 XP_011080180.1 PREDICTED: guanine nucleotide-binding protein-lik... 62 8e-09 NP_001234382.1 nuclear GTPase-like [Solanum lycopersicum] ABC268... 60 3e-08 OIT19073.1 hypothetical protein A4A49_42446 [Nicotiana attenuata] 55 9e-08 XP_009772077.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotid... 59 1e-07 XP_015079725.1 PREDICTED: guanine nucleotide-binding protein-lik... 59 1e-07 XP_009613889.1 PREDICTED: guanine nucleotide-binding protein-lik... 58 3e-07 GAU36447.1 hypothetical protein TSUD_19820 [Trifolium subterraneum] 56 1e-06 XP_019196647.1 PREDICTED: guanine nucleotide-binding protein-lik... 56 1e-06 XP_019249461.1 PREDICTED: guanine nucleotide-binding protein-lik... 55 2e-06 XP_015088013.1 PREDICTED: guanine nucleotide-binding protein-lik... 55 2e-06 >XP_009788644.1 PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Nicotiana sylvestris] XP_016512291.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana tabacum] Length = 611 Score = 68.9 bits (167), Expect = 3e-11 Identities = 38/65 (58%), Positives = 42/65 (64%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 K RKAEK+R+K K S D M+ DYDFKVDYVK DS MDDA D E S NRFE+ Sbjct: 545 KQRKAEKKRRKKDKPSTASDMMDDDYDFKVDYVKKDSAMDDAEDTETTDGS--KNNRFEL 602 Query: 182 PVEVD 196 P VD Sbjct: 603 PSGVD 607 >XP_016577496.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Capsicum annuum] Length = 607 Score = 66.6 bits (161), Expect = 2e-10 Identities = 36/61 (59%), Positives = 42/61 (68%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 KLRKAEK+R+K K+SA D M+ DYDFKVDY K +S MDD D A S KNRFE+ Sbjct: 541 KLRKAEKKRRKKDKASAASDMMDDDYDFKVDYFKKESIMDDTEDDITANES--KKNRFEL 598 Query: 182 P 184 P Sbjct: 599 P 599 >XP_019264838.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana attenuata] OIT36134.1 guanine nucleotide-binding protein-like nsn1 [Nicotiana attenuata] Length = 611 Score = 66.2 bits (160), Expect = 3e-10 Identities = 37/65 (56%), Positives = 41/65 (63%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 K RKAEK+R+K K S D M+ DYDFKVDYVK DS MDDA D S NRFE+ Sbjct: 545 KQRKAEKKRRKKDKPSTASDMMDDDYDFKVDYVKKDSAMDDAEDTVTTDGS--KNNRFEL 602 Query: 182 PVEVD 196 P VD Sbjct: 603 PSGVD 607 >KZN03879.1 hypothetical protein DCAR_012635 [Daucus carota subsp. sativus] Length = 570 Score = 65.1 bits (157), Expect = 7e-10 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 11/76 (14%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSK----- 166 K+RKA+KR KK KSS+ +DMEGDYDFKVDY K D+ DDA D E A+ PS Sbjct: 496 KVRKADKRAKKAKKSSST-EDMEGDYDFKVDYFKKDTVNDDASDEEDIPANTPSNDADTM 554 Query: 167 ------NRFEMPVEVD 196 ++ E P+E+D Sbjct: 555 DNTSTGSKLETPIELD 570 >XP_017243061.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Daucus carota subsp. sativus] Length = 611 Score = 65.1 bits (157), Expect = 7e-10 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 11/76 (14%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSK----- 166 K+RKA+KR KK KSS+ +DMEGDYDFKVDY K D+ DDA D E A+ PS Sbjct: 537 KVRKADKRAKKAKKSSST-EDMEGDYDFKVDYFKKDTVNDDASDEEDIPANTPSNDADTM 595 Query: 167 ------NRFEMPVEVD 196 ++ E P+E+D Sbjct: 596 DNTSTGSKLETPIELD 611 >XP_016435109.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana tabacum] Length = 605 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/61 (55%), Positives = 41/61 (67%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 KLRKAEK+R+K K+S D M+ DYDFKVDY K +S MDDA D + KNRFE+ Sbjct: 537 KLRKAEKKRRKKDKASTTSDMMDDDYDFKVDYFKKESIMDDAEDD--VIIDESKKNRFEI 594 Query: 182 P 184 P Sbjct: 595 P 595 >XP_009612778.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana tomentosiformis] Length = 605 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/61 (55%), Positives = 41/61 (67%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 KLRKAEK+R+K K+S D M+ DYDFKVDY K +S MDDA D + KNRFE+ Sbjct: 537 KLRKAEKKRRKKDKASTTSDMMDDDYDFKVDYFKKESIMDDAEDD--VIIDESKKNRFEI 594 Query: 182 P 184 P Sbjct: 595 P 595 >XP_004242396.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum lycopersicum] Length = 605 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/61 (55%), Positives = 41/61 (67%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 KLRKAEK+R+K ++S D M+ DYDFKVDY K +S MDDA D S KNRFE+ Sbjct: 539 KLRKAEKKRRKKDRASTTSDMMDSDYDFKVDYFKKESAMDDAEDDMPVNES--KKNRFEL 596 Query: 182 P 184 P Sbjct: 597 P 597 >XP_006364266.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum tuberosum] Length = 608 Score = 63.5 bits (153), Expect = 2e-09 Identities = 36/67 (53%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 K +KAEK+R+K K S DM+GDYDFKVDY+K DS MDDA +E NRFE+ Sbjct: 543 KQKKAEKKRRKKDKPST-ASDMDGDYDFKVDYIKKDSAMDDA--NEVVATDESKNNRFEL 599 Query: 182 P--VEVD 196 P VE+D Sbjct: 600 PSGVELD 606 >XP_015166521.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein-like NSN1 [Solanum tuberosum] Length = 607 Score = 63.2 bits (152), Expect = 3e-09 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +2 Query: 2 KLRKAEK-RRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFE 178 KLRKAEK RRKK S+ D M+GDYDFKVDY K +S MDDA D S KNRFE Sbjct: 540 KLRKAEKKRRKKDRASNXTSDMMDGDYDFKVDYFKKESAMDDAEDDMTPNES--KKNRFE 597 Query: 179 MP 184 +P Sbjct: 598 LP 599 >XP_011080180.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Sesamum indicum] Length = 601 Score = 62.0 bits (149), Expect = 8e-09 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = +2 Query: 2 KLRKAEKRR-KKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFE 178 KLRKA K+R +K + +AM D DYDFKVDYVK DS M D D E +A SKNRFE Sbjct: 533 KLRKAAKKRLRKENQPAAMEHDSNDDYDFKVDYVKRDSAM-DTSDGENDVAGESSKNRFE 591 Query: 179 MP--VEVD 196 +P VEVD Sbjct: 592 LPSGVEVD 599 >NP_001234382.1 nuclear GTPase-like [Solanum lycopersicum] ABC26876.1 putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 60.5 bits (145), Expect = 3e-08 Identities = 33/61 (54%), Positives = 39/61 (63%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 K +KAEK+R+K K S DM+GDYDFKVDY+K DS MDDA E NRFE+ Sbjct: 544 KQKKAEKKRRKKDKPST-AIDMDGDYDFKVDYIKKDSAMDDA--DEVVATDESKNNRFEL 600 Query: 182 P 184 P Sbjct: 601 P 601 >OIT19073.1 hypothetical protein A4A49_42446 [Nicotiana attenuata] Length = 88 Score = 55.5 bits (132), Expect = 9e-08 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGD 133 KLRKAEK+R+ K+S D M+ DYDFKVDY K +S MDDA D Sbjct: 34 KLRKAEKKRRMKDKASTTSDMMDDDYDFKVDYFKKESIMDDAED 77 >XP_009772077.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein-like 3 homolog [Nicotiana sylvestris] Length = 610 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 KLRKAEK+R + K+S D M+ DYDFKVDY +S MD+A D + KNRFE+ Sbjct: 537 KLRKAEKKRMRKDKASTTSDMMDDDYDFKVDYFSKESIMDNAKDD--VITGESKKNRFEI 594 Query: 182 P 184 P Sbjct: 595 P 595 >XP_015079725.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum pennellii] Length = 596 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGD 133 KLRKAEK+R+K K+S D M+ DYDFKVDY K +S MDDA D Sbjct: 541 KLRKAEKKRRKKDKASTTSDMMDSDYDFKVDYFKKESAMDDAED 584 >XP_009613889.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana tomentosiformis] Length = 600 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGD 133 K RKAEK+R+K K S D M DYDFKVDYVK DS MDDA D Sbjct: 545 KQRKAEKKRRKKDKPSTASDMMNDDYDFKVDYVKKDSAMDDAED 588 >GAU36447.1 hypothetical protein TSUD_19820 [Trifolium subterraneum] Length = 599 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGD-------SDMDDAGDHEAALASIP 160 K+R+AEK++KK + + D M+GDYDFKVDY K D SD D+ G+ E A +P Sbjct: 532 KIRRAEKKKKKKANKAGVSDPMDGDYDFKVDYFKKDAMDDESKSDDDNDGNDEQVNAEVP 591 Query: 161 SKNRFEMPVEVDE 199 VEV+E Sbjct: 592 MSG-----VEVEE 599 >XP_019196647.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Ipomoea nil] Length = 611 Score = 55.8 bits (133), Expect = 1e-06 Identities = 36/66 (54%), Positives = 42/66 (63%), Gaps = 5/66 (7%) Frame = +2 Query: 2 KLRKAEKRRKKTIK--SSAMGDDMEGDYDFKVDYVKGDSDMD--DAGDHEAALASIPS-K 166 KLRKAEKRR+K K SS M DD GDYDFKVDYVK S D ++ +A S + Sbjct: 540 KLRKAEKRRRKKEKEPSSMMEDD--GDYDFKVDYVKSSSSNSAMDVSENNIVIADDDSNR 597 Query: 167 NRFEMP 184 NRFE+P Sbjct: 598 NRFELP 603 >XP_019249461.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Nicotiana attenuata] OIT07148.1 guanine nucleotide-binding protein-like nsn1 [Nicotiana attenuata] Length = 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGD 133 KLRKAEK+R+ K+S D M+ DYDFKVDY K +S MDDA D Sbjct: 537 KLRKAEKKRRMKDKASTTSDMMDDDYDFKVDYFKKESIMDDAED 580 >XP_015088013.1 PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum pennellii] Length = 609 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/61 (50%), Positives = 37/61 (60%) Frame = +2 Query: 2 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 181 K +KAEK+R+K K S DM+ DYDFKVDY+K DS MD G E NRFE+ Sbjct: 544 KQKKAEKKRRKKDKPST-AIDMDDDYDFKVDYIKKDSAMD--GADEVVATDESKNNRFEL 600 Query: 182 P 184 P Sbjct: 601 P 601