BLASTX nr result
ID: Panax25_contig00021070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021070 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN02620.1 hypothetical protein DCAR_011374 [Daucus carota subsp... 58 4e-07 XP_017241880.1 PREDICTED: DExH-box ATP-dependent RNA helicase DE... 58 4e-07 CDO98393.1 unnamed protein product [Coffea canephora] 55 5e-06 XP_019177048.1 PREDICTED: DExH-box ATP-dependent RNA helicase DE... 54 6e-06 >KZN02620.1 hypothetical protein DCAR_011374 [Daucus carota subsp. sativus] Length = 1163 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 90 TGLVDNVESYNTWSHDEHLIRAITCAGLFP 1 TGLVD+V+ N+WSHDEHLIRAITCAGL+P Sbjct: 864 TGLVDDVDKCNSWSHDEHLIRAITCAGLYP 893 >XP_017241880.1 PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Daucus carota subsp. sativus] Length = 1180 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 90 TGLVDNVESYNTWSHDEHLIRAITCAGLFP 1 TGLVD+V+ N+WSHDEHLIRAITCAGL+P Sbjct: 881 TGLVDDVDKCNSWSHDEHLIRAITCAGLYP 910 >CDO98393.1 unnamed protein product [Coffea canephora] Length = 1212 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -2 Query: 87 GLVDNVESYNTWSHDEHLIRAITCAGLFP 1 GLVD++ES N WSHD+HLIRA+ CAGLFP Sbjct: 914 GLVDDIESCNQWSHDQHLIRAVICAGLFP 942 >XP_019177048.1 PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Ipomoea nil] Length = 1192 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 90 TGLVDNVESYNTWSHDEHLIRAITCAGLFP 1 +GLVD+ ES N WSHDEHL+RAI CAGLFP Sbjct: 889 SGLVDSGESCNIWSHDEHLVRAIVCAGLFP 918