BLASTX nr result
ID: Panax25_contig00021038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021038 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019175244.1 PREDICTED: AT-hook motif nuclear-localized protei... 61 3e-08 CDP11496.1 unnamed protein product [Coffea canephora] 57 6e-07 ABL63120.1 AT-hook DNA-binding protein [Catharanthus roseus] 57 8e-07 >XP_019175244.1 PREDICTED: AT-hook motif nuclear-localized protein 17-like [Ipomoea nil] Length = 339 Score = 60.8 bits (146), Expect = 3e-08 Identities = 34/67 (50%), Positives = 40/67 (59%), Gaps = 14/67 (20%) Frame = -3 Query: 160 IMKGDYGDEDKDHTNTMFAKIHQTQKFQ-----------PYPTPNTSAARHH-FQL--TT 23 +MKG+Y +E KDH+NTMFAK+HQTQKF P P P HH FQ+ Sbjct: 1 MMKGEYVEEMKDHSNTMFAKLHQTQKFHHHHHPYHQPPPPPPQPQAQPTFHHPFQVAAAA 60 Query: 22 RECQTSE 2 RECQTSE Sbjct: 61 RECQTSE 67 >CDP11496.1 unnamed protein product [Coffea canephora] Length = 329 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/56 (55%), Positives = 35/56 (62%), Gaps = 4/56 (7%) Frame = -3 Query: 157 MKGDYGDEDKD-HTNTMFAKIHQTQKF---QPYPTPNTSAARHHFQLTTRECQTSE 2 MKGDY E+KD H+N MFAK+HQTQKF P P P + HH RECQ SE Sbjct: 1 MKGDYVKEEKDGHSNPMFAKLHQTQKFLHHPPPPQPQPTTLLHH-SFNPRECQASE 55 >ABL63120.1 AT-hook DNA-binding protein [Catharanthus roseus] Length = 335 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/60 (48%), Positives = 40/60 (66%), Gaps = 8/60 (13%) Frame = -3 Query: 157 MKGDYGDEDKDHTNTMFAKIHQTQKFQPYPTPNTSAARHH--------FQLTTRECQTSE 2 MKG+Y ++KD+ ++MFAK+HQTQKF +P+P +A HH FQ+ RECQ SE Sbjct: 1 MKGEYVKDEKDNHSSMFAKLHQTQKFHHHPSPPHPSALHHHNNHHHNSFQV-PRECQNSE 59