BLASTX nr result
ID: Panax25_contig00021009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021009 (687 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009777819.1 PREDICTED: ethylene-responsive transcription fact... 59 1e-06 XP_009777818.1 PREDICTED: ethylene-responsive transcription fact... 59 1e-06 XP_009777817.1 PREDICTED: ethylene-responsive transcription fact... 59 1e-06 XP_009777816.1 PREDICTED: ethylene-responsive transcription fact... 59 1e-06 XP_016483059.1 PREDICTED: ethylene-responsive transcription fact... 59 1e-06 XP_016510285.1 PREDICTED: ethylene-responsive transcription fact... 58 2e-06 XP_016510284.1 PREDICTED: ethylene-responsive transcription fact... 58 2e-06 XP_019258504.1 PREDICTED: ethylene-responsive transcription fact... 58 3e-06 XP_019258503.1 PREDICTED: ethylene-responsive transcription fact... 58 3e-06 >XP_009777819.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X4 [Nicotiana sylvestris] Length = 364 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ+REMSAMVTALTHVVSG+R GELT YRPE Sbjct: 8 MFSGYSQTREMSAMVTALTHVVSGRRQGELT-YRPE 42 >XP_009777818.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X3 [Nicotiana sylvestris] Length = 365 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ+REMSAMVTALTHVVSG+R GELT YRPE Sbjct: 8 MFSGYSQTREMSAMVTALTHVVSGRRQGELT-YRPE 42 >XP_009777817.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X2 [Nicotiana sylvestris] Length = 366 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ+REMSAMVTALTHVVSG+R GELT YRPE Sbjct: 8 MFSGYSQTREMSAMVTALTHVVSGRRQGELT-YRPE 42 >XP_009777816.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X1 [Nicotiana sylvestris] XP_016483068.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X2 [Nicotiana tabacum] Length = 428 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ+REMSAMVTALTHVVSG+R GELT YRPE Sbjct: 71 MFSGYSQTREMSAMVTALTHVVSGRRQGELT-YRPE 105 >XP_016483059.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X1 [Nicotiana tabacum] Length = 429 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ+REMSAMVTALTHVVSG+R GELT YRPE Sbjct: 71 MFSGYSQTREMSAMVTALTHVVSGRRQGELT-YRPE 105 >XP_016510285.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X2 [Nicotiana tabacum] Length = 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+RYSQ+REMSAMVTALTHVVSG+R GE T YRP+ Sbjct: 74 MFSRYSQTREMSAMVTALTHVVSGRREGEWT-YRPD 108 >XP_016510284.1 PREDICTED: ethylene-responsive transcription factor ABR1-like isoform X1 [Nicotiana tabacum] Length = 450 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+RYSQ+REMSAMVTALTHVVSG+R GE T YRP+ Sbjct: 74 MFSRYSQTREMSAMVTALTHVVSGRREGEWT-YRPD 108 >XP_019258504.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X2 [Nicotiana attenuata] Length = 427 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ++EMSAMVTALTHVVSG+R GELT YRPE Sbjct: 72 MFSGYSQTKEMSAMVTALTHVVSGRRQGELT-YRPE 106 >XP_019258503.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Nicotiana attenuata] OIT40494.1 ethylene-responsive transcription factor abr1 [Nicotiana attenuata] Length = 428 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 214 MFTRYSQSREMSAMVTALTHVVSGQRSGELTYYRPE 107 MF+ YSQ++EMSAMVTALTHVVSG+R GELT YRPE Sbjct: 72 MFSGYSQTKEMSAMVTALTHVVSGRRQGELT-YRPE 106