BLASTX nr result
ID: Panax25_contig00020876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020876 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH88780.1 cytochrome b561, eukaryote [Cynara cardunculus var. s... 76 3e-13 XP_017222879.1 PREDICTED: probable ascorbate-specific transmembr... 68 8e-11 XP_006448097.1 hypothetical protein CICLE_v10017511mg [Citrus cl... 66 3e-10 XP_006469332.1 PREDICTED: probable ascorbate-specific transmembr... 66 4e-10 XP_011028106.1 PREDICTED: probable ascorbate-specific transmembr... 64 2e-09 XP_019226112.1 PREDICTED: probable ascorbate-specific transmembr... 63 6e-09 XP_016478632.1 PREDICTED: probable ascorbate-specific transmembr... 63 6e-09 XP_002281627.1 PREDICTED: probable ascorbate-specific transmembr... 63 6e-09 EOY01308.1 Cytochrome b561/ferric reductase transmembrane protei... 61 9e-09 OMO60819.1 Cytochrome b561, eukaryote [Corchorus capsularis] 63 1e-08 XP_002312479.1 hypothetical protein POPTR_0008s13760g [Populus t... 62 1e-08 XP_017970672.1 PREDICTED: probable ascorbate-specific transmembr... 61 2e-08 XP_015071471.1 PREDICTED: probable ascorbate-specific transmembr... 62 2e-08 XP_018629261.1 PREDICTED: probable ascorbate-specific transmembr... 61 2e-08 XP_017970671.1 PREDICTED: probable ascorbate-specific transmembr... 61 2e-08 XP_004228748.1 PREDICTED: probable ascorbate-specific transmembr... 61 3e-08 XP_009802978.1 PREDICTED: probable ascorbate-specific transmembr... 60 4e-08 XP_016537454.1 PREDICTED: probable ascorbate-specific transmembr... 60 4e-08 XP_002527545.1 PREDICTED: probable ascorbate-specific transmembr... 60 6e-08 XP_010936901.1 PREDICTED: probable ascorbate-specific transmembr... 60 8e-08 >KVH88780.1 cytochrome b561, eukaryote [Cynara cardunculus var. scolymus] Length = 416 Score = 76.3 bits (186), Expect = 3e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 394 SICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 +IC F L+ WLLAFFSF++PGAES RS+M PWHVFFG+VIFFM IVT Sbjct: 323 TICLFGLQ--WLLAFFSFVYPGAESARRSRMVPWHVFFGVVIFFMTIVT 369 >XP_017222879.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Daucus carota subsp. sativus] KZM85762.1 hypothetical protein DCAR_026816 [Daucus carota subsp. sativus] Length = 222 Score = 67.8 bits (164), Expect = 8e-11 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 394 SICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 + C F L+ +L AFFSF+FPGA+SG RS+MAP+HVFFGIVIF MAI++ Sbjct: 130 TFCLFGLQ--FLFAFFSFVFPGADSGARSRMAPYHVFFGIVIFLMAIIS 176 >XP_006448097.1 hypothetical protein CICLE_v10017511mg [Citrus clementina] ESR61337.1 hypothetical protein CICLE_v10017511mg [Citrus clementina] Length = 202 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC + L+ WLLAFFS++FPGAE R PWH FFG+VIFF+AI T Sbjct: 106 LGMITICLYGLQ--WLLAFFSYVFPGAEMSARGSFLPWHSFFGLVIFFLAICT 156 >XP_006469332.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Citrus sinensis] Length = 221 Score = 65.9 bits (159), Expect = 4e-10 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC + L+ WLLAFFS++FPGAE R PWH FFG+VIFF+AI T Sbjct: 125 LGMITICLYGLQ--WLLAFFSYVFPGAEMSARGSFLPWHSFFGLVIFFLAICT 175 >XP_011028106.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Populus euphratica] Length = 223 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAI 254 L + +IC F L+ WLL FFSF+FPGAE R+ PWHVF G+VIFF+AI Sbjct: 125 LGMITICLFGLQ--WLLGFFSFVFPGAEMSARASYRPWHVFGGLVIFFLAI 173 >XP_019226112.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana attenuata] XP_019226113.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana attenuata] OIT32229.1 putative ascorbate-specific transmembrane electron transporter 1 [Nicotiana attenuata] Length = 221 Score = 62.8 bits (151), Expect = 6e-09 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 379 LLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 L +WLL+F +F+FPGA + TRS++APWH GI+IFF+AIV Sbjct: 130 LFAFQWLLSFLTFLFPGARTSTRSRVAPWHALIGIIIFFLAIV 172 >XP_016478632.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana tabacum] Length = 221 Score = 62.8 bits (151), Expect = 6e-09 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 379 LLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 L +WLL+F +F+FPGA + TRS++APWH GI+IFF+AIV Sbjct: 130 LFALQWLLSFLTFLFPGARTSTRSRVAPWHALIGIIIFFLAIV 172 >XP_002281627.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Vitis vinifera] CBI26789.3 unnamed protein product, partial [Vitis vinifera] Length = 222 Score = 62.8 bits (151), Expect = 6e-09 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F L+ W+ AFFSF FPGAE TR ++ PWH F G+VIF MAI+T Sbjct: 125 LGLSTICLFGLQ--WVFAFFSFWFPGAEMPTRGRLMPWHWFAGMVIFLMAILT 175 >EOY01308.1 Cytochrome b561/ferric reductase transmembrane protein family, putative [Theobroma cacao] Length = 165 Score = 61.2 bits (147), Expect = 9e-09 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F L+ LL FFSF+FPGAES +R+ PWH+F G+VIFF+AI T Sbjct: 68 LGMIAICLFGLQL--LLGFFSFVFPGAESYSRAGYTPWHIFGGLVIFFLAIAT 118 >OMO60819.1 Cytochrome b561, eukaryote [Corchorus capsularis] Length = 374 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F + WLLAFFSF+FP AES +R+ PWHVF G+VIFF+AI T Sbjct: 277 LGMIAICLFGFQ--WLLAFFSFIFPRAESSSRAGYRPWHVFGGLVIFFLAIGT 327 >XP_002312479.1 hypothetical protein POPTR_0008s13760g [Populus trichocarpa] EEE89846.1 hypothetical protein POPTR_0008s13760g [Populus trichocarpa] Length = 223 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAI 254 L + +IC F L+ WLL FFSF+FPGAE R PWHVF G+ IFF+AI Sbjct: 125 LGMITICLFGLQ--WLLGFFSFVFPGAEMSARGSYRPWHVFGGLAIFFLAI 173 >XP_017970672.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 isoform X2 [Theobroma cacao] Length = 194 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F L+ LL FFSF+FPGAES +R+ PWH+F G+VIFF+AI T Sbjct: 97 LGMIAICLFGLQL--LLGFFSFVFPGAESYSRAGYTPWHIFGGLVIFFLAIAT 147 >XP_015071471.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Solanum pennellii] Length = 221 Score = 61.6 bits (148), Expect = 2e-08 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 367 RWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 +W+L+F +F++PGA S TRS++APWH GI IFFMAIV Sbjct: 139 QWILSFLTFLYPGARSSTRSRVAPWHALIGITIFFMAIV 177 >XP_018629261.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana tomentosiformis] XP_018629262.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana tomentosiformis] XP_018629266.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana tomentosiformis] Length = 221 Score = 61.2 bits (147), Expect = 2e-08 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 379 LLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 L +WLL+F +F+FPGA + TRS++ PWH GI+IFF+AIV Sbjct: 130 LFALQWLLSFLTFLFPGARTSTRSRVVPWHALIGIIIFFLAIV 172 >XP_017970671.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 isoform X1 [Theobroma cacao] Length = 224 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F L+ LL FFSF+FPGAES +R+ PWH+F G+VIFF+AI T Sbjct: 127 LGMIAICLFGLQL--LLGFFSFVFPGAESYSRAGYTPWHIFGGLVIFFLAIAT 177 >XP_004228748.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Solanum lycopersicum] Length = 221 Score = 60.8 bits (146), Expect = 3e-08 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -2 Query: 367 RWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 +W+++F +F++PGA S TRS++APWH GI IFFMAIV Sbjct: 139 QWIMSFLTFLYPGARSSTRSRVAPWHALIGITIFFMAIV 177 >XP_009802978.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana sylvestris] XP_009802979.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana sylvestris] XP_009802980.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Nicotiana sylvestris] Length = 221 Score = 60.5 bits (145), Expect = 4e-08 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 379 LLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIV 251 L +WLL+F +F+FPGA + TRS++APWH GI+IF +AIV Sbjct: 130 LFALQWLLSFLTFLFPGARTSTRSRVAPWHALIGIIIFLLAIV 172 >XP_016537454.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Capsicum annuum] Length = 226 Score = 60.5 bits (145), Expect = 4e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -2 Query: 367 RWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 +W+L+F +F+FP A + TRS++APWH GI IFFMAIVT Sbjct: 144 QWILSFLTFLFPRARTSTRSRVAPWHALIGITIFFMAIVT 183 >XP_002527545.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Ricinus communis] EEF34854.1 cytochrome B561, putative [Ricinus communis] Length = 218 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -2 Query: 406 LPIFSICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAIVT 248 L + +IC F L+ W+L FFS++FPGAE +R+ PWHVF G+ IFF+AI T Sbjct: 125 LGMCTICLFGLQ--WVLGFFSYVFPGAEMSSRAAYMPWHVFGGMFIFFLAICT 175 >XP_010936901.1 PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Elaeis guineensis] Length = 221 Score = 59.7 bits (143), Expect = 8e-08 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = -2 Query: 394 SICYFLLKSRWLLAFFSFMFPGAESGTRSKMAPWHVFFGIVIFFMAI 254 +IC + L+ W++AFFSF+FPG R+ M PWH FFG VIF MAI Sbjct: 130 TICLYALQ--WVIAFFSFIFPGTTYSMRANMKPWHAFFGAVIFLMAI 174