BLASTX nr result
ID: Panax25_contig00020653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020653 (1078 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010255243.1 PREDICTED: deSI-like protein At4g17486 [Nelumbo n... 122 5e-29 KRH38388.1 hypothetical protein GLYMA_09G132800 [Glycine max] KR... 119 1e-28 ACU22856.1 unknown [Glycine max] 119 1e-28 XP_018838614.1 PREDICTED: deSI-like protein At4g17486 [Juglans r... 120 2e-28 XP_015067280.1 PREDICTED: desumoylating isopeptidase 2-like [Sol... 120 2e-28 XP_015571300.1 PREDICTED: uncharacterized protein LOC8277105 [Ri... 119 3e-28 XP_006353912.1 PREDICTED: desumoylating isopeptidase 2-like [Sol... 119 5e-28 EEF49061.1 conserved hypothetical protein [Ricinus communis] 119 6e-28 XP_003533983.1 PREDICTED: deSI-like protein At4g17486 [Glycine m... 119 7e-28 KDO56774.1 hypothetical protein CISIN_1g025261mg [Citrus sinensi... 117 7e-28 KYP61893.1 UPF0326 protein At4g17486 family [Cajanus cajan] KYP6... 116 1e-27 CBI22663.3 unnamed protein product, partial [Vitis vinifera] 118 1e-27 XP_009798709.1 PREDICTED: deSI-like protein At4g17486 [Nicotiana... 118 1e-27 XP_002273259.1 PREDICTED: deSI-like protein At4g17486 [Vitis vin... 118 1e-27 XP_004234227.1 PREDICTED: desumoylating isopeptidase 2 [Solanum ... 117 1e-27 XP_012858378.1 PREDICTED: desumoylating isopeptidase 2-like [Ery... 117 2e-27 KRH08876.1 hypothetical protein GLYMA_16G179500 [Glycine max] 117 2e-27 XP_014624574.1 PREDICTED: deSI-like protein At4g17486 [Glycine m... 117 3e-27 XP_011084455.1 PREDICTED: deSI-like protein At4g17486 [Sesamum i... 117 4e-27 KDO56773.1 hypothetical protein CISIN_1g025261mg [Citrus sinensis] 117 4e-27 >XP_010255243.1 PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera] Length = 246 Score = 122 bits (305), Expect = 5e-29 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLG TNFSIFKVNQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRECIVLGNTNFSIFKVNQILRELSREWPGDSYDLLSKNCNHFCDEFCERLGVPKLP 132 >KRH38388.1 hypothetical protein GLYMA_09G132800 [Glycine max] KRH38389.1 hypothetical protein GLYMA_09G132800 [Glycine max] Length = 176 Score = 119 bits (297), Expect = 1e-28 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFK+NQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 4 YRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 60 >ACU22856.1 unknown [Glycine max] Length = 176 Score = 119 bits (297), Expect = 1e-28 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFK+NQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 4 YRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 60 >XP_018838614.1 PREDICTED: deSI-like protein At4g17486 [Juglans regia] XP_018838615.1 PREDICTED: deSI-like protein At4g17486 [Juglans regia] Length = 249 Score = 120 bits (301), Expect = 2e-28 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLG+T+FSIFKVNQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRECIVLGQTSFSIFKVNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 132 >XP_015067280.1 PREDICTED: desumoylating isopeptidase 2-like [Solanum pennellii] Length = 237 Score = 120 bits (300), Expect = 2e-28 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -3 Query: 176 NYRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 +YRECIVLG TN SIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGV KLP Sbjct: 75 SYRECIVLGNTNHSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVQKLP 132 >XP_015571300.1 PREDICTED: uncharacterized protein LOC8277105 [Ricinus communis] Length = 215 Score = 119 bits (297), Expect = 3e-28 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFKVNQILRELSREWPG +YDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 4 YRESIVLGKTNFSIFKVNQILRELSREWPGSAYDLLSKNCNHFCDEFCERLGVPKLP 60 >XP_006353912.1 PREDICTED: desumoylating isopeptidase 2-like [Solanum tuberosum] Length = 237 Score = 119 bits (297), Expect = 5e-28 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = -3 Query: 176 NYRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 +YRECIVLG TN SIFKVN+ILRELSREWPGHSYDLLSKNCNHFCDEFCERLGV KLP Sbjct: 75 SYRECIVLGNTNHSIFKVNEILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVQKLP 132 >EEF49061.1 conserved hypothetical protein [Ricinus communis] Length = 244 Score = 119 bits (297), Expect = 6e-28 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFKVNQILRELSREWPG +YDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 33 YRESIVLGKTNFSIFKVNQILRELSREWPGSAYDLLSKNCNHFCDEFCERLGVPKLP 89 >XP_003533983.1 PREDICTED: deSI-like protein At4g17486 [Glycine max] KHN03676.1 UPF0326 protein [Glycine soja] KRH38387.1 hypothetical protein GLYMA_09G132800 [Glycine max] Length = 248 Score = 119 bits (297), Expect = 7e-28 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFK+NQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 132 >KDO56774.1 hypothetical protein CISIN_1g025261mg [Citrus sinensis] KDO56775.1 hypothetical protein CISIN_1g025261mg [Citrus sinensis] KDO56776.1 hypothetical protein CISIN_1g025261mg [Citrus sinensis] Length = 183 Score = 117 bits (292), Expect = 7e-28 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFKVNQILRELSREWPG+SYDLL +NCNHFCDEFC+RLGVPKLP Sbjct: 4 YRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLP 60 >KYP61893.1 UPF0326 protein At4g17486 family [Cajanus cajan] KYP61894.1 UPF0326 protein At4g17486 family [Cajanus cajan] Length = 182 Score = 116 bits (291), Expect = 1e-27 Identities = 53/57 (92%), Positives = 54/57 (94%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLGKTN SIFKVNQILRELSREWPG SYDLL+KNCNHFCDEFCERLGV KLP Sbjct: 4 YRECIVLGKTNSSIFKVNQILRELSREWPGSSYDLLAKNCNHFCDEFCERLGVQKLP 60 >CBI22663.3 unnamed protein product, partial [Vitis vinifera] Length = 243 Score = 118 bits (295), Expect = 1e-27 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLG+TNFSIFKVNQILRELSREWPG SYDLL+KNCNHFCDE CE+LGVPKLP Sbjct: 75 YRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNCNHFCDELCEKLGVPKLP 131 >XP_009798709.1 PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris] Length = 246 Score = 118 bits (295), Expect = 1e-27 Identities = 53/57 (92%), Positives = 54/57 (94%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLG TN SIFKVNQILRELSREWPGHSYDLL+KNCNHFCDEFCERLGV KLP Sbjct: 76 YRECIVLGTTNHSIFKVNQILRELSREWPGHSYDLLAKNCNHFCDEFCERLGVQKLP 132 >XP_002273259.1 PREDICTED: deSI-like protein At4g17486 [Vitis vinifera] Length = 247 Score = 118 bits (295), Expect = 1e-27 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRECIVLG+TNFSIFKVNQILRELSREWPG SYDLL+KNCNHFCDE CE+LGVPKLP Sbjct: 79 YRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNCNHFCDELCEKLGVPKLP 135 >XP_004234227.1 PREDICTED: desumoylating isopeptidase 2 [Solanum lycopersicum] Length = 237 Score = 117 bits (294), Expect = 1e-27 Identities = 53/58 (91%), Positives = 54/58 (93%) Frame = -3 Query: 176 NYRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 +YRECIVLG TN SIFKVNQILRELSREWPGHSYDLLSKNCNHFCDE CERLGV KLP Sbjct: 75 SYRECIVLGNTNHSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDELCERLGVQKLP 132 >XP_012858378.1 PREDICTED: desumoylating isopeptidase 2-like [Erythranthe guttata] EYU19578.1 hypothetical protein MIMGU_mgv1a012735mg [Erythranthe guttata] Length = 241 Score = 117 bits (294), Expect = 2e-27 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE I LG+T+FSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRESIKLGQTSFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 132 >KRH08876.1 hypothetical protein GLYMA_16G179500 [Glycine max] Length = 215 Score = 117 bits (292), Expect = 2e-27 Identities = 54/57 (94%), Positives = 54/57 (94%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTN SIFKVNQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 46 YRESIVLGKTNCSIFKVNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 102 >XP_014624574.1 PREDICTED: deSI-like protein At4g17486 [Glycine max] KHN09305.1 UPF0326 protein [Glycine soja] KRH08874.1 hypothetical protein GLYMA_16G179500 [Glycine max] Length = 245 Score = 117 bits (292), Expect = 3e-27 Identities = 54/57 (94%), Positives = 54/57 (94%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTN SIFKVNQILRELSREWPG SYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRESIVLGKTNCSIFKVNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLP 132 >XP_011084455.1 PREDICTED: deSI-like protein At4g17486 [Sesamum indicum] Length = 248 Score = 117 bits (292), Expect = 4e-27 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE I LG+T+FSI+KVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP Sbjct: 76 YRESIKLGRTSFSIYKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 132 >KDO56773.1 hypothetical protein CISIN_1g025261mg [Citrus sinensis] Length = 252 Score = 117 bits (292), Expect = 4e-27 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -3 Query: 173 YRECIVLGKTNFSIFKVNQILRELSREWPGHSYDLLSKNCNHFCDEFCERLGVPKLP 3 YRE IVLGKTNFSIFKVNQILRELSREWPG+SYDLL +NCNHFCDEFC+RLGVPKLP Sbjct: 73 YRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLP 129