BLASTX nr result
ID: Panax25_contig00020521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020521 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017246736.1 PREDICTED: putative ribosomal-protein-alanine ace... 56 2e-07 XP_011085967.1 PREDICTED: N-alpha-acetyltransferase 10 [Sesamum ... 55 7e-07 XP_016541562.1 PREDICTED: putative ribosomal-protein-alanine ace... 53 3e-06 >XP_017246736.1 PREDICTED: putative ribosomal-protein-alanine acetyltransferase [Daucus carota subsp. sativus] Length = 162 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 12 RARSIHCISLHVDP*RIAAMNLYKKFGFQVDDL 110 RAR++H ISLHVDP R AA+NLYKKFGFQVD L Sbjct: 109 RARNVHRISLHVDPSRTAALNLYKKFGFQVDSL 141 >XP_011085967.1 PREDICTED: N-alpha-acetyltransferase 10 [Sesamum indicum] Length = 159 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 12 RARSIHCISLHVDP*RIAAMNLYKKFGFQVDDL 110 + R+IH ISLHVDP RIAAMNLYKK GFQVD L Sbjct: 106 KTRNIHRISLHVDPSRIAAMNLYKKLGFQVDSL 138 >XP_016541562.1 PREDICTED: putative ribosomal-protein-alanine acetyltransferase [Capsicum annuum] Length = 157 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 12 RARSIHCISLHVDP*RIAAMNLYKKFGFQVDDL 110 R R++H ISLHVDP RIAAM LYKK GFQVD L Sbjct: 104 RTRNVHRISLHVDPTRIAAMQLYKKLGFQVDSL 136