BLASTX nr result
ID: Panax25_contig00020271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020271 (916 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007215313.1 hypothetical protein PRUPE_ppa003531mg [Prunus pe... 60 1e-06 ONI17332.1 hypothetical protein PRUPE_3G152100 [Prunus persica] 60 1e-06 ONI17333.1 hypothetical protein PRUPE_3G152100 [Prunus persica] 60 1e-06 >XP_007215313.1 hypothetical protein PRUPE_ppa003531mg [Prunus persica] Length = 567 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 780 IQSEGDLTTVNRKEDKYIEYEESRKNKRKKKQVTTPRPACSWVHF 914 + SEGD+ V R ++ + E RK K+KKKQVTTPRPACSWV+F Sbjct: 2 VSSEGDVMLVKRNAEENVVLEGKRKRKKKKKQVTTPRPACSWVYF 46 >ONI17332.1 hypothetical protein PRUPE_3G152100 [Prunus persica] Length = 622 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 780 IQSEGDLTTVNRKEDKYIEYEESRKNKRKKKQVTTPRPACSWVHF 914 + SEGD+ V R ++ + E RK K+KKKQVTTPRPACSWV+F Sbjct: 2 VSSEGDVMLVKRNAEENVVLEGKRKRKKKKKQVTTPRPACSWVYF 46 >ONI17333.1 hypothetical protein PRUPE_3G152100 [Prunus persica] Length = 631 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 780 IQSEGDLTTVNRKEDKYIEYEESRKNKRKKKQVTTPRPACSWVHF 914 + SEGD+ V R ++ + E RK K+KKKQVTTPRPACSWV+F Sbjct: 11 VSSEGDVMLVKRNAEENVVLEGKRKRKKKKKQVTTPRPACSWVYF 55