BLASTX nr result
ID: Panax25_contig00020080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020080 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016177947.1 PREDICTED: protein TPR3-like [Arachis ipaensis] 55 1e-06 KDO71781.1 hypothetical protein CISIN_1g001178mg [Citrus sinensis] 56 2e-06 XP_006489019.1 PREDICTED: topless-related protein 2 [Citrus sine... 56 2e-06 KDO71780.1 hypothetical protein CISIN_1g001178mg [Citrus sinensis] 56 2e-06 XP_006419483.1 hypothetical protein CICLE_v10004197mg [Citrus cl... 56 2e-06 OMO96694.1 hypothetical protein CCACVL1_04832 [Corchorus capsula... 56 3e-06 XP_014516359.1 PREDICTED: topless-related protein 1-like [Vigna ... 56 3e-06 XP_017407538.1 PREDICTED: topless-related protein 1 [Vigna angul... 56 3e-06 XP_007135775.1 hypothetical protein PHAVU_010G157700g [Phaseolus... 56 3e-06 KYP43842.1 Vegetative incompatibility protein HET-E-1 [Cajanus c... 55 4e-06 XP_019419032.1 PREDICTED: topless-related protein 2-like isoform... 55 4e-06 XP_019419031.1 PREDICTED: topless-related protein 2-like isoform... 55 4e-06 OMP11455.1 hypothetical protein COLO4_03799 [Corchorus olitorius] 55 4e-06 XP_004508183.1 PREDICTED: topless-related protein 2 [Cicer ariet... 55 4e-06 XP_019159949.1 PREDICTED: protein TOPLESS-like isoform X2 [Ipomo... 55 4e-06 XP_019159948.1 PREDICTED: protein TOPLESS-like isoform X1 [Ipomo... 55 4e-06 XP_019258812.1 PREDICTED: protein TOPLESS-like [Nicotiana attenu... 55 4e-06 XP_016482177.1 PREDICTED: protein TOPLESS-like isoform X2 [Nicot... 55 4e-06 XP_009796750.1 PREDICTED: protein TOPLESS-like [Nicotiana sylves... 55 4e-06 XP_009611336.1 PREDICTED: protein TOPLESS-like [Nicotiana toment... 55 4e-06 >XP_016177947.1 PREDICTED: protein TPR3-like [Arachis ipaensis] Length = 141 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 98 IDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 129 >KDO71781.1 hypothetical protein CISIN_1g001178mg [Citrus sinensis] Length = 1130 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFSY NKQLC++TCG + +R Sbjct: 450 IDAHVGGVNDLAFSYPNKQLCIVTCGDDKLIR 481 >XP_006489019.1 PREDICTED: topless-related protein 2 [Citrus sinensis] Length = 1130 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFSY NKQLC++TCG + +R Sbjct: 450 IDAHVGGVNDLAFSYPNKQLCIVTCGDDKLIR 481 >KDO71780.1 hypothetical protein CISIN_1g001178mg [Citrus sinensis] Length = 1131 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFSY NKQLC++TCG + +R Sbjct: 450 IDAHVGGVNDLAFSYPNKQLCIVTCGDDKLIR 481 >XP_006419483.1 hypothetical protein CICLE_v10004197mg [Citrus clementina] ESR32723.1 hypothetical protein CICLE_v10004197mg [Citrus clementina] Length = 1131 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFSY NKQLC++TCG + +R Sbjct: 450 IDAHVGGVNDLAFSYPNKQLCIVTCGDDKLIR 481 >OMO96694.1 hypothetical protein CCACVL1_04832 [Corchorus capsularis] Length = 1108 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -1 Query: 134 CAGN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 C G+ D L IDAH+GGVNDLAF++ NKQLC++TCG + ++ Sbjct: 445 CPGSNDLIQRLEIDAHVGGVNDLAFAHPNKQLCIVTCGDDKLIK 488 >XP_014516359.1 PREDICTED: topless-related protein 1-like [Vigna radiata var. radiata] XP_014516360.1 PREDICTED: topless-related protein 1-like [Vigna radiata var. radiata] Length = 1136 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFS+ NKQLCVITCG + +R Sbjct: 458 IDAHVGGVNDLAFSHPNKQLCVITCGDDKTIR 489 >XP_017407538.1 PREDICTED: topless-related protein 1 [Vigna angularis] KOM27272.1 hypothetical protein LR48_Vigan406s008200 [Vigna angularis] BAT98599.1 hypothetical protein VIGAN_09226500 [Vigna angularis var. angularis] Length = 1136 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFS+ NKQLCVITCG + +R Sbjct: 458 IDAHVGGVNDLAFSHPNKQLCVITCGDDKTIR 489 >XP_007135775.1 hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] XP_007135776.1 hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] ESW07769.1 hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] ESW07770.1 hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] Length = 1137 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFS+ NKQLCVITCG + +R Sbjct: 457 IDAHVGGVNDLAFSHPNKQLCVITCGDDKTIR 488 >KYP43842.1 Vegetative incompatibility protein HET-E-1 [Cajanus cajan] Length = 226 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 53 IDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 84 >XP_019419032.1 PREDICTED: topless-related protein 2-like isoform X4 [Lupinus angustifolius] Length = 896 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCG 21 IDAH+GGVNDLAFS+LNKQLC++TCG Sbjct: 213 IDAHVGGVNDLAFSHLNKQLCIVTCG 238 >XP_019419031.1 PREDICTED: topless-related protein 2-like isoform X3 [Lupinus angustifolius] Length = 950 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCG 21 IDAH+GGVNDLAFS+LNKQLC++TCG Sbjct: 449 IDAHVGGVNDLAFSHLNKQLCIVTCG 474 >OMP11455.1 hypothetical protein COLO4_03799 [Corchorus olitorius] Length = 959 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -1 Query: 134 CAGN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCG 21 C G+ D L IDAH+GGVNDLAF++ NKQLC++TCG Sbjct: 325 CPGSNDLIQRLEIDAHVGGVNDLAFAHPNKQLCIVTCG 362 >XP_004508183.1 PREDICTED: topless-related protein 2 [Cicer arietinum] Length = 1125 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 IDAH+GGVNDLAFSY NKQLCV+TCG + ++ Sbjct: 450 IDAHVGGVNDLAFSYPNKQLCVVTCGDDKLIK 481 >XP_019159949.1 PREDICTED: protein TOPLESS-like isoform X2 [Ipomoea nil] Length = 1126 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487 >XP_019159948.1 PREDICTED: protein TOPLESS-like isoform X1 [Ipomoea nil] Length = 1127 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487 >XP_019258812.1 PREDICTED: protein TOPLESS-like [Nicotiana attenuata] XP_019258813.1 PREDICTED: protein TOPLESS-like [Nicotiana attenuata] OIT40270.1 protein topless [Nicotiana attenuata] Length = 1127 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487 >XP_016482177.1 PREDICTED: protein TOPLESS-like isoform X2 [Nicotiana tabacum] XP_016482178.1 PREDICTED: protein TOPLESS-like isoform X2 [Nicotiana tabacum] Length = 1127 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487 >XP_009796750.1 PREDICTED: protein TOPLESS-like [Nicotiana sylvestris] XP_009796751.1 PREDICTED: protein TOPLESS-like [Nicotiana sylvestris] Length = 1127 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487 >XP_009611336.1 PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis] XP_009611337.1 PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis] XP_016506568.1 PREDICTED: protein TOPLESS-like [Nicotiana tabacum] XP_016506569.1 PREDICTED: protein TOPLESS-like [Nicotiana tabacum] XP_018629194.1 PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis] Length = 1127 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 128 GN*DWFILL*IDAHIGGVNDLAFSYLNKQLCVITCGTKRPLR 3 GN D L IDAH+GGVNDLAFS+ NKQLCVITCG + ++ Sbjct: 446 GNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIK 487