BLASTX nr result
ID: Panax25_contig00020074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00020074 (815 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009176028.1 clp protease proteolytic subunit (chloroplast) [F... 64 3e-08 ANY93398.3 ClpP (chloroplast) [Hagenia abyssinica] 58 3e-06 >YP_009176028.1 clp protease proteolytic subunit (chloroplast) [Ficus racemosa] ALI30724.1 clp protease proteolytic subunit (chloroplast) [Ficus racemosa] Length = 267 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +2 Query: 611 FFYNKEGSKNSSFLKNRRKVLSLEVRKRIGIYTLIL-FFAFFVEPYAPKDACTVSKGYNL 787 FFY ++ +S+ + L+++ K+ IYTLIL FFA VE YA KDACTV KGYN Sbjct: 33 FFYERKSPFVTSYTE-----LAMKKEKKTRIYTLILVFFAICVELYASKDACTVPKGYNF 87 Query: 788 TPINRLYRE 814 INRLYRE Sbjct: 88 ISINRLYRE 96 >ANY93398.3 ClpP (chloroplast) [Hagenia abyssinica] Length = 283 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +2 Query: 710 LILFFAFFVEPYAPKDACTVSKGYNLTPINRLYRE 814 + LFF FVEPYA K ACTVSKGY+ PINRLYRE Sbjct: 23 VFLFFMIFVEPYASKGACTVSKGYHFIPINRLYRE 57