BLASTX nr result
ID: Panax25_contig00019919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019919 (490 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015058328.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 6e-10 XP_004228746.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 6e-10 XP_019258624.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 8e-10 XP_016500898.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 8e-10 XP_009778367.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 8e-10 XP_009595830.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 8e-10 XP_019176524.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 67 8e-10 XP_016537449.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 65 3e-09 XP_006364054.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 65 3e-09 AEQ54916.1 trehalose-6-phosphate synthase [Salvia miltiorrhiza] 64 5e-09 XP_017226566.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 63 1e-08 XP_011070555.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 62 4e-08 EPS59044.1 hypothetical protein M569_15766, partial [Genlisea au... 60 1e-07 KZV19549.1 alpha,alpha-trehalose-phosphate synthase [Dorcoceras ... 59 3e-07 AHL29280.1 trehalose-phosphate synthase 6 [Camellia sinensis] 59 3e-07 CBI26812.3 unnamed protein product, partial [Vitis vinifera] 57 1e-06 EOY01375.1 UDP-Glycosyltransferase / trehalose-phosphatase famil... 57 1e-06 XP_006378432.1 hypothetical protein POPTR_0010s11510g [Populus t... 57 1e-06 XP_011021751.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 57 1e-06 XP_012846125.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 57 1e-06 >XP_015058328.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum pennellii] XP_015058336.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum pennellii] Length = 857 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 33 >XP_004228746.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum lycopersicum] XP_010316481.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum lycopersicum] Length = 857 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 33 >XP_019258624.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Nicotiana attenuata] OIT40399.1 alpha,alpha-trehalose-phosphate synthase [udp-forming] 6 [Nicotiana attenuata] Length = 856 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIM 33 >XP_016500898.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Nicotiana tabacum] Length = 856 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIM 33 >XP_009778367.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Nicotiana sylvestris] Length = 856 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIM 33 >XP_009595830.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Nicotiana tomentosiformis] XP_016491153.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Nicotiana tabacum] XP_018624940.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Nicotiana tomentosiformis] Length = 856 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIM 33 >XP_019176524.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Ipomoea nil] Length = 858 Score = 66.6 bits (161), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIM 33 >XP_016537449.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] XP_016537450.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] XP_016537451.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] Length = 857 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRM RRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMGRRIPRIM 33 >XP_006364054.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] XP_015159238.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] XP_015159239.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] Length = 857 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSFGRMS+RIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFGRMSQRIPRIM 33 >AEQ54916.1 trehalose-6-phosphate synthase [Salvia miltiorrhiza] Length = 857 Score = 64.3 bits (155), Expect = 5e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSF RMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFSRMSRRIPRIM 33 >XP_017226566.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Daucus carota subsp. sativus] KZM82716.1 hypothetical protein DCAR_030285 [Daucus carota subsp. sativus] Length = 859 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGE PSPS GRMSRRIPRVM Sbjct: 1 MVSRSYSNLLELASGEGPSPSLGRMSRRIPRVM 33 >XP_011070555.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Sesamum indicum] Length = 856 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAPSPSF RM RR+PR+M Sbjct: 1 MVSRSYSNLLELASGEAPSPSFSRMRRRLPRIM 33 >EPS59044.1 hypothetical protein M569_15766, partial [Genlisea aurea] Length = 862 Score = 60.1 bits (144), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLEL SGEAP PSF R+SRRIPRVM Sbjct: 1 MVSRSYSNLLELVSGEAPGPSFSRISRRIPRVM 33 >KZV19549.1 alpha,alpha-trehalose-phosphate synthase [Dorcoceras hygrometricum] Length = 856 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEAP P+ GR+SRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEAPLPNIGRISRRIPRIM 33 >AHL29280.1 trehalose-phosphate synthase 6 [Camellia sinensis] Length = 856 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGE+P PSF RM RRIPR+M Sbjct: 1 MVSRSYSNLLELASGESPVPSFSRMGRRIPRIM 33 >CBI26812.3 unnamed protein product, partial [Vitis vinifera] Length = 702 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGE SPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGE--SPSFGRMSRRIPRIM 31 >EOY01375.1 UDP-Glycosyltransferase / trehalose-phosphatase family protein isoform 3 [Theobroma cacao] Length = 777 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGEA PSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGEA--PSFGRMSRRIPRIM 31 >XP_006378432.1 hypothetical protein POPTR_0010s11510g [Populus trichocarpa] ERP56229.1 hypothetical protein POPTR_0010s11510g [Populus trichocarpa] Length = 815 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGE SPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGE--SPSFGRMSRRIPRIM 31 >XP_011021751.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 isoform X2 [Populus euphratica] Length = 832 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNLLELASGE SPSFGRMSRRIPR+M Sbjct: 1 MVSRSYSNLLELASGE--SPSFGRMSRRIPRIM 31 >XP_012846125.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Erythranthe guttata] EYU30144.1 hypothetical protein MIMGU_mgv1a001255mg [Erythranthe guttata] Length = 852 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 390 MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVM 488 MVSRSYSNL++LASGEA SPSF R+SRRIPR+M Sbjct: 1 MVSRSYSNLMDLASGEAQSPSFTRLSRRIPRIM 33