BLASTX nr result
ID: Panax25_contig00019736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019736 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015888039.1 PREDICTED: cyclin-T1-4-like isoform X3 [Ziziphus ... 65 3e-10 KDO74682.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] 65 4e-10 XP_015888038.1 PREDICTED: cyclin-T1-4-like isoform X2 [Ziziphus ... 65 4e-10 KDO74678.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] 65 4e-10 XP_006489355.1 PREDICTED: cyclin-T1-4 isoform X2 [Citrus sinensi... 65 4e-10 JAT53257.1 Cyclin-T1-4, partial [Anthurium amnicola] JAT60647.1 ... 65 4e-10 XP_006419885.1 hypothetical protein CICLE_v10005160mg [Citrus cl... 65 4e-10 XP_015888036.1 PREDICTED: cyclin-T1-4-like isoform X1 [Ziziphus ... 65 4e-10 XP_006489353.1 PREDICTED: cyclin-T1-4 isoform X1 [Citrus sinensi... 65 4e-10 XP_006419886.1 hypothetical protein CICLE_v10005160mg [Citrus cl... 65 4e-10 JAT40656.1 Cyclin-T1-4, partial [Anthurium amnicola] 65 4e-10 KJB12515.1 hypothetical protein B456_002G023700 [Gossypium raimo... 65 5e-10 KJB12510.1 hypothetical protein B456_002G023700 [Gossypium raimo... 65 5e-10 KHG26364.1 Cyclin-T1-4 [Gossypium arboreum] 65 5e-10 KJB12513.1 hypothetical protein B456_002G023700 [Gossypium raimo... 65 5e-10 XP_012069591.1 PREDICTED: cyclin-T1-4-like isoform X3 [Jatropha ... 65 5e-10 KJB12514.1 hypothetical protein B456_002G023700 [Gossypium raimo... 65 5e-10 XP_017974667.1 PREDICTED: cyclin-T1-4 isoform X3 [Theobroma cacao] 65 5e-10 XP_017974665.1 PREDICTED: cyclin-T1-4 isoform X2 [Theobroma caca... 65 5e-10 JAT56927.1 Cyclin-T1-5, partial [Anthurium amnicola] JAT65356.1 ... 65 5e-10 >XP_015888039.1 PREDICTED: cyclin-T1-4-like isoform X3 [Ziziphus jujuba] Length = 318 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 249 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 279 >KDO74682.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] Length = 323 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 264 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 294 >XP_015888038.1 PREDICTED: cyclin-T1-4-like isoform X2 [Ziziphus jujuba] Length = 324 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 249 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 279 >KDO74678.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] Length = 341 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 264 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 294 >XP_006489355.1 PREDICTED: cyclin-T1-4 isoform X2 [Citrus sinensis] KDO74679.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] KDO74680.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] KDO74681.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] Length = 343 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 264 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 294 >JAT53257.1 Cyclin-T1-4, partial [Anthurium amnicola] JAT60647.1 Cyclin-T1-4, partial [Anthurium amnicola] Length = 284 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 225 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 255 >XP_006419885.1 hypothetical protein CICLE_v10005160mg [Citrus clementina] ESR33125.1 hypothetical protein CICLE_v10005160mg [Citrus clementina] Length = 353 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 266 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 296 >XP_015888036.1 PREDICTED: cyclin-T1-4-like isoform X1 [Ziziphus jujuba] XP_015888037.1 PREDICTED: cyclin-T1-4-like isoform X1 [Ziziphus jujuba] Length = 366 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 249 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 279 >XP_006489353.1 PREDICTED: cyclin-T1-4 isoform X1 [Citrus sinensis] XP_006489354.1 PREDICTED: cyclin-T1-4 isoform X1 [Citrus sinensis] KDO74677.1 hypothetical protein CISIN_1g016851mg [Citrus sinensis] Length = 381 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 264 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 294 >XP_006419886.1 hypothetical protein CICLE_v10005160mg [Citrus clementina] ESR33126.1 hypothetical protein CICLE_v10005160mg [Citrus clementina] Length = 383 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 266 IDWFEQYRERVIEAEQMILTTLNFELNVQHP 296 >JAT40656.1 Cyclin-T1-4, partial [Anthurium amnicola] Length = 297 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 225 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 255 >KJB12515.1 hypothetical protein B456_002G023700 [Gossypium raimondii] Length = 311 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 255 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 285 >KJB12510.1 hypothetical protein B456_002G023700 [Gossypium raimondii] KJB12512.1 hypothetical protein B456_002G023700 [Gossypium raimondii] KJB12516.1 hypothetical protein B456_002G023700 [Gossypium raimondii] Length = 314 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 255 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 285 >KHG26364.1 Cyclin-T1-4 [Gossypium arboreum] Length = 318 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 228 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 258 >KJB12513.1 hypothetical protein B456_002G023700 [Gossypium raimondii] Length = 320 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 255 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 285 >XP_012069591.1 PREDICTED: cyclin-T1-4-like isoform X3 [Jatropha curcas] Length = 323 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 261 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 291 >KJB12514.1 hypothetical protein B456_002G023700 [Gossypium raimondii] Length = 323 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 255 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 285 >XP_017974667.1 PREDICTED: cyclin-T1-4 isoform X3 [Theobroma cacao] Length = 326 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 257 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 287 >XP_017974665.1 PREDICTED: cyclin-T1-4 isoform X2 [Theobroma cacao] XP_017974666.1 PREDICTED: cyclin-T1-4 isoform X2 [Theobroma cacao] Length = 329 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 257 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 287 >JAT56927.1 Cyclin-T1-5, partial [Anthurium amnicola] JAT65356.1 Cyclin-T1-5, partial [Anthurium amnicola] Length = 342 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 LDWFEQYRERVIEAEQIILTTLNFELNVQHP 3 +DWFEQYRERVIEAEQ+ILTTLNFELNVQHP Sbjct: 225 VDWFEQYRERVIEAEQMILTTLNFELNVQHP 255