BLASTX nr result
ID: Panax25_contig00019544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019544 (692 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006373614.1 hypothetical protein POPTR_0016s013101g, partial ... 54 4e-06 XP_017233022.1 PREDICTED: putative MO25-like protein At5g47540 [... 55 4e-06 XP_006373612.1 hypothetical protein POPTR_0016s013101g, partial ... 53 4e-06 >XP_006373614.1 hypothetical protein POPTR_0016s013101g, partial [Populus trichocarpa] ERP51411.1 hypothetical protein POPTR_0016s013101g, partial [Populus trichocarpa] Length = 108 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/60 (55%), Positives = 39/60 (65%) Frame = +1 Query: 193 IFLLYFFISVDEPLKITFEELCTRHKSTVAEFLAKNYDWVDLSDSNNILVRLINYIWIRR 372 I L YF IS D TF+EL TRHKSTVAEFL+KNYDW ++ N L+ NYI R+ Sbjct: 15 IQLPYFDISADAAA--TFKELLTRHKSTVAEFLSKNYDWF-FAEFNLKLLESTNYITRRQ 71 >XP_017233022.1 PREDICTED: putative MO25-like protein At5g47540 [Daucus carota subsp. sativus] KZN04066.1 hypothetical protein DCAR_004903 [Daucus carota subsp. sativus] Length = 125 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +1 Query: 241 TFEELCTRHKSTVAEFLAKNYDWVDLSDSNNILVRLINYIWIRR 372 TF+ELCTRHKSTVAEFL+KNYDW ++ N+ L+ NYI R+ Sbjct: 42 TFKELCTRHKSTVAEFLSKNYDWF-FAEYNSKLLEPPNYITRRQ 84 >XP_006373612.1 hypothetical protein POPTR_0016s013101g, partial [Populus trichocarpa] ERP51409.1 hypothetical protein POPTR_0016s013101g, partial [Populus trichocarpa] Length = 59 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 193 IFLLYFFISVDEPLKITFEELCTRHKSTVAEFLAKNYDWV 312 I L YF IS D TF+EL TRHKSTVAEFL+KNYDWV Sbjct: 15 IQLPYFDISADAAA--TFKELLTRHKSTVAEFLSKNYDWV 52