BLASTX nr result
ID: Panax25_contig00019253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019253 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019077344.1 PREDICTED: auxin transporter-like protein 2 isofo... 68 1e-10 CAN72381.1 hypothetical protein VITISV_038019 [Vitis vinifera] 68 2e-10 XP_002279219.1 PREDICTED: auxin transporter-like protein 2 isofo... 68 2e-10 KHG20422.1 Auxin transporter-like protein 4 [Gossypium arboreum] 65 1e-09 XP_017608694.1 PREDICTED: auxin transporter-like protein 2 [Goss... 65 1e-09 XP_016671073.1 PREDICTED: auxin transporter-like protein 2 [Goss... 65 1e-09 XP_016669806.1 PREDICTED: auxin transporter-like protein 2 [Goss... 65 1e-09 XP_012486210.1 PREDICTED: auxin transporter-like protein 2 [Goss... 65 1e-09 XP_017223132.1 PREDICTED: auxin transporter-like protein 2 [Dauc... 64 3e-09 XP_016183916.1 PREDICTED: auxin transporter-like protein 2 [Arac... 64 3e-09 XP_015950287.1 PREDICTED: auxin transporter-like protein 2 [Arac... 64 4e-09 XP_007026762.2 PREDICTED: auxin transporter-like protein 2 [Theo... 64 5e-09 EOY07264.1 Transmembrane amino acid transporter family protein i... 64 5e-09 XP_019430187.1 PREDICTED: auxin transporter-like protein 4 [Lupi... 64 5e-09 OIW19988.1 hypothetical protein TanjilG_31885 [Lupinus angustifo... 64 5e-09 XP_010030821.1 PREDICTED: auxin transporter-like protein 4 [Euca... 63 7e-09 BAH47612.1 auxin influx carrier protein [Zinnia violacea] 63 9e-09 XP_004302648.1 PREDICTED: auxin transporter-like protein 2 [Frag... 63 9e-09 ABN81349.1 auxin influx transport protein [Casuarina glauca] ABN... 62 1e-08 XP_011019137.1 PREDICTED: auxin transporter-like protein 2 [Popu... 62 2e-08 >XP_019077344.1 PREDICTED: auxin transporter-like protein 2 isoform X2 [Vitis vinifera] Length = 392 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 295 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH Sbjct: 357 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 385 >CAN72381.1 hypothetical protein VITISV_038019 [Vitis vinifera] Length = 478 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 295 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH Sbjct: 443 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 471 >XP_002279219.1 PREDICTED: auxin transporter-like protein 2 isoform X1 [Vitis vinifera] CBI30413.3 unnamed protein product, partial [Vitis vinifera] Length = 478 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 295 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH Sbjct: 443 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 471 >KHG20422.1 Auxin transporter-like protein 4 [Gossypium arboreum] Length = 457 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP---QHH 292 ASMTNFVRQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 425 ASMTNFVRQIDTFGLFAKCYQCKPPTPAAAQHH 457 >XP_017608694.1 PREDICTED: auxin transporter-like protein 2 [Gossypium arboreum] Length = 478 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP---QHH 292 ASMTNFVRQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 446 ASMTNFVRQIDTFGLFAKCYQCKPPTPAAAQHH 478 >XP_016671073.1 PREDICTED: auxin transporter-like protein 2 [Gossypium hirsutum] Length = 478 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP---QHH 292 ASMTNFVRQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 446 ASMTNFVRQIDTFGLFAKCYQCKPPTPAAAQHH 478 >XP_016669806.1 PREDICTED: auxin transporter-like protein 2 [Gossypium hirsutum] Length = 478 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP---QHH 292 ASMTNFVRQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 446 ASMTNFVRQIDTFGLFAKCYQCKPPTPAAAQHH 478 >XP_012486210.1 PREDICTED: auxin transporter-like protein 2 [Gossypium raimondii] KJB36889.1 hypothetical protein B456_006G181400 [Gossypium raimondii] KJB36890.1 hypothetical protein B456_006G181400 [Gossypium raimondii] Length = 478 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP---QHH 292 ASMTNFVRQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 446 ASMTNFVRQIDTFGLFAKCYQCKPPTPAAAQHH 478 >XP_017223132.1 PREDICTED: auxin transporter-like protein 2 [Daucus carota subsp. sativus] KZM83760.1 hypothetical protein DCAR_028818 [Daucus carota subsp. sativus] Length = 473 Score = 64.3 bits (155), Expect = 3e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH 292 ASMTNFV+QVD+FGLFAKCYQCKPP P HH Sbjct: 444 ASMTNFVKQVDSFGLFAKCYQCKPPAPHHH 473 >XP_016183916.1 PREDICTED: auxin transporter-like protein 2 [Arachis ipaensis] XP_016183917.1 PREDICTED: auxin transporter-like protein 2 [Arachis ipaensis] Length = 504 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH*PASTVSP 268 ASMTNFVRQ+DTFGLFAKCYQCKPP P H PA+ P Sbjct: 462 ASMTNFVRQIDTFGLFAKCYQCKPPLPPPH-PAAVAPP 498 >XP_015950287.1 PREDICTED: auxin transporter-like protein 2 [Arachis duranensis] XP_015950288.1 PREDICTED: auxin transporter-like protein 2 [Arachis duranensis] Length = 504 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH*PASTVSP 268 ASMTNF+RQ+DTFGLFAKCYQCKPP P H PA+ P Sbjct: 462 ASMTNFIRQIDTFGLFAKCYQCKPPLPPPH-PAAVAPP 498 >XP_007026762.2 PREDICTED: auxin transporter-like protein 2 [Theobroma cacao] Length = 480 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 6/36 (16%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP------QHH 292 ASMTNF+RQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 445 ASMTNFIRQIDTFGLFAKCYQCKPPTPVPGAAAQHH 480 >EOY07264.1 Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] EOY07265.1 Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 480 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 6/36 (16%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP------QHH 292 ASMTNF+RQ+DTFGLFAKCYQCKPPTP QHH Sbjct: 445 ASMTNFIRQIDTFGLFAKCYQCKPPTPVPGAAAQHH 480 >XP_019430187.1 PREDICTED: auxin transporter-like protein 4 [Lupinus angustifolius] XP_019430188.1 PREDICTED: auxin transporter-like protein 4 [Lupinus angustifolius] Length = 486 Score = 63.5 bits (153), Expect = 5e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 295 ASMTNFVRQ+D+FGLFAKCYQCKPPTP H Sbjct: 447 ASMTNFVRQIDSFGLFAKCYQCKPPTPPH 475 >OIW19988.1 hypothetical protein TanjilG_31885 [Lupinus angustifolius] Length = 488 Score = 63.5 bits (153), Expect = 5e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQH 295 ASMTNFVRQ+D+FGLFAKCYQCKPPTP H Sbjct: 449 ASMTNFVRQIDSFGLFAKCYQCKPPTPPH 477 >XP_010030821.1 PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis] XP_010030875.1 PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis] KCW88117.1 hypothetical protein EUGRSUZ_A00514 [Eucalyptus grandis] KCW88118.1 hypothetical protein EUGRSUZ_A00514 [Eucalyptus grandis] Length = 489 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH*PASTVSPY 265 ASMTNFVRQVDTFGLFAKCYQCKPP P P +T +P+ Sbjct: 454 ASMTNFVRQVDTFGLFAKCYQCKPPPP----PPATAAPH 488 >BAH47612.1 auxin influx carrier protein [Zinnia violacea] Length = 476 Score = 62.8 bits (151), Expect = 9e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH 292 ASMTNF+ QVDTFGLFAKCYQCKPPTP H+ Sbjct: 446 ASMTNFIDQVDTFGLFAKCYQCKPPTPTHN 475 >XP_004302648.1 PREDICTED: auxin transporter-like protein 2 [Fragaria vesca subsp. vesca] XP_011466485.1 PREDICTED: auxin transporter-like protein 2 [Fragaria vesca subsp. vesca] Length = 484 Score = 62.8 bits (151), Expect = 9e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTP 301 ASMTNFVRQVDTFGLFAKCYQCKPPTP Sbjct: 450 ASMTNFVRQVDTFGLFAKCYQCKPPTP 476 >ABN81349.1 auxin influx transport protein [Casuarina glauca] ABN81350.1 auxin influx transport protein [Casuarina glauca] Length = 480 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH*PASTVSP 268 ASMTNFVRQVDTFGLFAKCYQCKPP P PA+ +P Sbjct: 444 ASMTNFVRQVDTFGLFAKCYQCKPPPP----PAAAAAP 477 >XP_011019137.1 PREDICTED: auxin transporter-like protein 2 [Populus euphratica] XP_011019138.1 PREDICTED: auxin transporter-like protein 2 [Populus euphratica] XP_011019139.1 PREDICTED: auxin transporter-like protein 2 [Populus euphratica] Length = 481 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -1 Query: 381 ASMTNFVRQVDTFGLFAKCYQCKPPTPQHH*PASTVSP 268 ASMTNFVRQVDTFGLFAKCYQCKPP P PA+ P Sbjct: 445 ASMTNFVRQVDTFGLFAKCYQCKPPAP----PAAAAPP 478