BLASTX nr result
ID: Panax25_contig00019241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019241 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT09137.1 Os09g0534800, partial [Oryza sativa Japonica Group] 54 1e-06 ONM23119.1 Transcription initiation factor IIB-2 [Zea mays] 54 1e-06 ACF84713.1 unknown [Zea mays] 54 5e-06 EMT25381.1 Transcription initiation factor IIB [Aegilops tauschii] 54 5e-06 AAP80618.1 transcription factor TFIIB, partial [Triticum aestivum] 52 6e-06 XP_010935048.1 PREDICTED: transcription initiation factor IIB [E... 54 7e-06 XP_009409174.1 PREDICTED: transcription initiation factor IIB-li... 54 7e-06 XP_008799413.1 PREDICTED: transcription initiation factor IIB-li... 54 7e-06 XP_008788640.1 PREDICTED: transcription initiation factor IIB-li... 54 7e-06 XP_006660890.1 PREDICTED: transcription initiation factor IIB [O... 54 7e-06 XP_015651154.1 PREDICTED: transcription initiation factor IIB [O... 54 7e-06 XP_020187100.1 transcription initiation factor IIB [Aegilops tau... 54 9e-06 OEL24987.1 Transcription initiation factor IIB [Dichanthelium ol... 54 9e-06 XP_009409510.1 PREDICTED: transcription initiation factor IIB [M... 54 9e-06 NP_001149721.1 transcription initiation factor IIB [Zea mays] AC... 54 9e-06 ACF81664.1 unknown [Zea mays] ONM56801.1 Transcription initiatio... 54 9e-06 XP_004957467.1 PREDICTED: transcription initiation factor IIB [S... 54 9e-06 XP_003578512.1 PREDICTED: transcription initiation factor IIB [B... 54 9e-06 BAK05040.1 predicted protein [Hordeum vulgare subsp. vulgare] 54 9e-06 XP_002460572.1 hypothetical protein SORBIDRAFT_02g031020 [Sorghu... 54 9e-06 >BAT09137.1 Os09g0534800, partial [Oryza sativa Japonica Group] Length = 123 Score = 53.9 bits (128), Expect = 1e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 54 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 102 >ONM23119.1 Transcription initiation factor IIB-2 [Zea mays] Length = 115 Score = 53.5 bits (127), Expect = 1e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 46 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 94 >ACF84713.1 unknown [Zea mays] Length = 198 Score = 53.5 bits (127), Expect = 5e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 129 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 177 >EMT25381.1 Transcription initiation factor IIB [Aegilops tauschii] Length = 198 Score = 53.5 bits (127), Expect = 5e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 129 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 177 >AAP80618.1 transcription factor TFIIB, partial [Triticum aestivum] Length = 111 Score = 51.6 bits (122), Expect = 6e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKGNL 118 RRSPISIAAAVIY++TQLS DKKPLKG L Sbjct: 21 RRSPISIAAAVIYMITQLSEDKKPLKGYL 49 >XP_010935048.1 PREDICTED: transcription initiation factor IIB [Elaeis guineensis] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_009409174.1 PREDICTED: transcription initiation factor IIB-like [Musa acuminata subsp. malaccensis] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIKNSYKDLYPY 291 >XP_008799413.1 PREDICTED: transcription initiation factor IIB-like [Phoenix dactylifera] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_008788640.1 PREDICTED: transcription initiation factor IIB-like [Phoenix dactylifera] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_006660890.1 PREDICTED: transcription initiation factor IIB [Oryza brachyantha] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_015651154.1 PREDICTED: transcription initiation factor IIB [Oryza sativa Japonica Group] Q8W0W3.1 RecName: Full=Transcription initiation factor IIB; AltName: Full=General transcription factor TFIIB AAL73491.1 general transcription factor TFIIB [Oryza sativa] BAD33339.1 Transcription initiation factor IIB [Oryza sativa Japonica Group] BAD34211.1 Transcription initiation factor IIB [Oryza sativa Japonica Group] BAF25689.1 Os09g0534800 [Oryza sativa Japonica Group] EAZ09877.1 hypothetical protein OsI_32170 [Oryza sativa Indica Group] EAZ45480.1 hypothetical protein OsJ_30135 [Oryza sativa Japonica Group] AEP20532.1 transcription factor [Oryza sativa Japonica Group] BAT09136.1 Os09g0534800 [Oryza sativa Japonica Group] Length = 312 Score = 53.9 bits (128), Expect = 7e-06 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_020187100.1 transcription initiation factor IIB [Aegilops tauschii subsp. tauschii] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >OEL24987.1 Transcription initiation factor IIB [Dichanthelium oligosanthes] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_009409510.1 PREDICTED: transcription initiation factor IIB [Musa acuminata subsp. malaccensis] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAA+IY++TQLS+DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAIIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >NP_001149721.1 transcription initiation factor IIB [Zea mays] ACG36522.1 transcription initiation factor IIB [Zea mays] ONM23118.1 Transcription initiation factor IIB-2 [Zea mays] ONM23120.1 Transcription initiation factor IIB-2 [Zea mays] ONM23122.1 Transcription initiation factor IIB-2 [Zea mays] ONM23123.1 Transcription initiation factor IIB-2 [Zea mays] ONM23126.1 Transcription initiation factor IIB-2 [Zea mays] ONM23128.1 Transcription initiation factor IIB-2 [Zea mays] ONM23129.1 Transcription initiation factor IIB-2 [Zea mays] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >ACF81664.1 unknown [Zea mays] ONM56801.1 Transcription initiation factor IIB-2 [Zea mays] ONM56804.1 Transcription initiation factor IIB-2 [Zea mays] ONM56806.1 Transcription initiation factor IIB-2 [Zea mays] ONM56808.1 Transcription initiation factor IIB-2 [Zea mays] ONM56809.1 Transcription initiation factor IIB-2 [Zea mays] ONM56812.1 Transcription initiation factor IIB-2 [Zea mays] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_004957467.1 PREDICTED: transcription initiation factor IIB [Setaria italica] KQL25465.1 hypothetical protein SETIT_030598mg [Setaria italica] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_003578512.1 PREDICTED: transcription initiation factor IIB [Brachypodium distachyon] KQJ91212.1 hypothetical protein BRADI_4g36290 [Brachypodium distachyon] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >BAK05040.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291 >XP_002460572.1 hypothetical protein SORBIDRAFT_02g031020 [Sorghum bicolor] EER97093.1 hypothetical protein SORBI_002G276900 [Sorghum bicolor] Length = 312 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 204 RRSPISIAAAVIYIVTQLSNDKKPLKG-NLYIIFCVGLQTNSYQTLFTY 61 RRSPISIAAAVIY++TQLS DKKPLK +L G NSY+ L+ Y Sbjct: 243 RRSPISIAAAVIYMITQLSEDKKPLKDISLATGVAEGTIRNSYKDLYPY 291