BLASTX nr result
ID: Panax25_contig00019220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019220 (1348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV29919.1 hypothetical protein F511_17343 [Dorcoceras hygrometr... 54 6e-06 >KZV29919.1 hypothetical protein F511_17343 [Dorcoceras hygrometricum] Length = 81 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 1192 EFQRRNRVYKEEQRQLRAAAQNPKGEGGDRAHH 1094 EFQRRNRVYKEEQRQLRAAA+ KG G D AHH Sbjct: 50 EFQRRNRVYKEEQRQLRAAAEKGKGHGDD-AHH 81