BLASTX nr result
ID: Panax25_contig00019108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019108 (626 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP07897.1 unnamed protein product [Coffea canephora] 56 8e-06 >CDP07897.1 unnamed protein product [Coffea canephora] Length = 552 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -2 Query: 625 KVLYHKAIEDVGCLPLSPRGDTFVPIAGCC 536 KVLYHK+ EDV CLP+SP D FVPIAGCC Sbjct: 523 KVLYHKSSEDVSCLPMSPHADRFVPIAGCC 552