BLASTX nr result
ID: Panax25_contig00019038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019038 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017702195.1 PREDICTED: zinc finger BED domain-containing prot... 56 2e-11 XP_017250711.1 PREDICTED: zinc finger BED domain-containing prot... 59 4e-11 XP_008780286.1 PREDICTED: zinc finger BED domain-containing prot... 56 4e-11 XP_008779896.1 PREDICTED: zinc finger BED domain-containing prot... 52 1e-10 XP_008779743.1 PREDICTED: zinc finger BED domain-containing prot... 55 3e-10 XP_016166020.1 PREDICTED: zinc finger BED domain-containing prot... 54 2e-09 XP_015950046.1 PREDICTED: zinc finger BED domain-containing prot... 52 6e-09 XP_012575474.1 PREDICTED: zinc finger BED domain-containing prot... 50 2e-08 XP_012568925.1 PREDICTED: zinc finger BED domain-containing prot... 50 2e-08 XP_012575095.1 PREDICTED: zinc finger BED domain-containing prot... 50 2e-08 XP_015962322.1 PREDICTED: zinc finger BED domain-containing prot... 51 2e-08 XP_019177592.1 PREDICTED: zinc finger BED domain-containing prot... 49 3e-08 XP_019163645.1 PREDICTED: zinc finger BED domain-containing prot... 49 3e-08 XP_019157996.1 PREDICTED: zinc finger BED domain-containing prot... 49 3e-08 XP_019151811.1 PREDICTED: zinc finger BED domain-containing prot... 49 3e-08 XP_011093469.1 PREDICTED: zinc finger BED domain-containing prot... 47 3e-08 XP_019158453.1 PREDICTED: zinc finger BED domain-containing prot... 49 3e-08 GAU36100.1 hypothetical protein TSUD_277110 [Trifolium subterran... 51 4e-08 XP_015964988.1 PREDICTED: zinc finger BED domain-containing prot... 52 5e-08 KRG90264.1 hypothetical protein GLYMA_20G078600 [Glycine max] 49 5e-08 >XP_017702195.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 131 Score = 55.8 bits (133), Expect(2) = 2e-11 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DILSIP+ VASE+ FSAGGRVLDQ+RSSLKP+ Sbjct: 58 DILSIPITTVASEAAFSAGGRVLDQYRSSLKPE 90 Score = 40.0 bits (92), Expect(2) = 2e-11 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 TVQALICTGDWLR E +++S DE+ Q Sbjct: 91 TVQALICTGDWLRQELGLEQSSNVDEEFTQ 120 >XP_017250711.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 710 Score = 58.5 bits (140), Expect(2) = 4e-11 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DILS+P+ VASESTFSAGGRVLDQ+RSSLKP+ Sbjct: 632 DILSVPITTVASESTFSAGGRVLDQYRSSLKPE 664 Score = 36.2 bits (82), Expect(2) = 4e-11 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRI 152 TV+ALICT DWLRA+Y+I Sbjct: 665 TVEALICTSDWLRADYKI 682 >XP_008780286.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 55.8 bits (133), Expect(2) = 4e-11 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DILSIP+ VASE+ FSAGGRVLDQ+RSSLKP+ Sbjct: 125 DILSIPITTVASEAAFSAGGRVLDQYRSSLKPE 157 Score = 38.9 bits (89), Expect(2) = 4e-11 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 TV+ALICTGDWL E +++S DE+ MQ Sbjct: 158 TVEALICTGDWLHHELGLEQSSNVDEEFMQ 187 >XP_008779896.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 52.4 bits (124), Expect(2) = 1e-10 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DILS+P+ VASE+ FSAGGRVLDQ+ SSLKP+ Sbjct: 125 DILSVPITTVASEAAFSAGGRVLDQYCSSLKPE 157 Score = 40.8 bits (94), Expect(2) = 1e-10 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 TV+ALICTGDWLR E +++S DE+ MQ Sbjct: 158 TVEALICTGDWLRHELGLEQSSNVDEEFMQ 187 >XP_008779743.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 663 Score = 55.1 bits (131), Expect(2) = 3e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 DILSIP+ VASE+ FSAGGRVLDQ+RSSLKP Sbjct: 593 DILSIPITTVASEAAFSAGGRVLDQYRSSLKP 624 Score = 37.0 bits (84), Expect(2) = 3e-10 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 TVQALICT DWL E +++S DE+ MQ Sbjct: 626 TVQALICTRDWLHHELGLEQSSNVDEEFMQ 655 >XP_016166020.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis ipaensis] Length = 724 Score = 53.9 bits (128), Expect(2) = 2e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 D+L+IP++ VASESTFSAGGRV+D FRSSL P Sbjct: 657 DVLAIPILTVASESTFSAGGRVIDTFRSSLSP 688 Score = 35.0 bits (79), Expect(2) = 2e-09 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIK-KSMIADEDSMQEVSL 200 TV+ALIC GDWLR Y ++ KS + EDS E++L Sbjct: 690 TVEALICGGDWLRVFYGLRNKSKV--EDSSVEITL 722 >XP_015950046.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis duranensis] Length = 561 Score = 52.4 bits (124), Expect(2) = 6e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 D+L+IP+ VASESTFSAGGRV+D FRSSL P Sbjct: 494 DVLAIPISTVASESTFSAGGRVIDTFRSSLSP 525 Score = 35.0 bits (79), Expect(2) = 6e-09 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIK-KSMIADEDSMQEVSL 200 TV+ALIC GDWLR Y ++ KS + EDS E++L Sbjct: 527 TVEALICGGDWLRVFYGLRNKSKV--EDSSVEIAL 559 >XP_012575474.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 558 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 D+L+IP+ VASESTFSAGGRV+D+FRS L + Sbjct: 491 DVLAIPISTVASESTFSAGGRVIDEFRSKLNEE 523 Score = 36.2 bits (82), Expect(2) = 2e-08 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 +V+ALIC GDW R +Y +KK D+ +Q Sbjct: 524 SVEALICGGDWFRHKYNVKKKSKVDKQEIQ 553 >XP_012568925.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 352 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 D+L+IP+ VASESTFSAGGRV+D+FRS L + Sbjct: 285 DVLAIPISTVASESTFSAGGRVIDEFRSKLNEE 317 Score = 36.2 bits (82), Expect(2) = 2e-08 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 +V+ALIC GDW R +Y +KK D+ +Q Sbjct: 318 SVEALICGGDWFRHKYNVKKKSKVDKQEIQ 347 >XP_012575095.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 351 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 D+L+IP+ VASESTFSAGGRV+D+FRS L + Sbjct: 284 DVLAIPISTVASESTFSAGGRVIDEFRSKLNEE 316 Score = 36.2 bits (82), Expect(2) = 2e-08 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQ 188 +V+ALIC GDW R +Y +KK D+ +Q Sbjct: 317 SVEALICGGDWFRHKYNVKKKSKVDKQEIQ 346 >XP_015962322.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 314 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 D+L+IP+ V SESTFSAGGRV+D FRSSL P Sbjct: 247 DVLAIPISTVVSESTFSAGGRVIDTFRSSLSP 278 Score = 35.0 bits (79), Expect(2) = 2e-08 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIK-KSMIADEDSMQEVSL 200 TV+ALIC GDWLR Y ++ KS + EDS E++L Sbjct: 280 TVEALICGGDWLRVFYGLRNKSKV--EDSSVEITL 312 >XP_019177592.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 532 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL++P+ +VASESTFSAGGRV+D++R+SL + Sbjct: 465 DILAVPISSVASESTFSAGGRVIDEYRASLNEE 497 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLE 203 +++ALIC GDWLR +Y +KK D QE+ L+ Sbjct: 498 SIEALICGGDWLRNKYGLKKKQKGD-SGQQEIMLK 531 >XP_019163645.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 209 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL++P+ +VASESTFSAGGRV+D++R+SL + Sbjct: 142 DILAVPISSVASESTFSAGGRVIDEYRASLNEE 174 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLE 203 +++ALIC GDWLR +Y +KK D QE+ L+ Sbjct: 175 SIEALICGGDWLRNKYGLKKKQKGD-SGQQEIMLK 208 >XP_019157996.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 209 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL++P+ +VASESTFSAGGRV+D++R+SL + Sbjct: 142 DILAVPISSVASESTFSAGGRVIDEYRASLNEE 174 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLE 203 +++ALIC GDWLR +Y +KK D QE+ L+ Sbjct: 175 SIEALICGGDWLRNKYGLKKKQKGD-SGQQEIMLK 208 >XP_019151811.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] XP_019167435.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] XP_019167436.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 209 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL++P+ +VASESTFSAGGRV+D++R+SL + Sbjct: 142 DILAVPISSVASESTFSAGGRVIDEYRASLNEE 174 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLE 203 +++ALIC GDWLR +Y +KK D QE+ L+ Sbjct: 175 SIEALICGGDWLRNKYGLKKKQKGD-SGQQEIMLK 208 >XP_011093469.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X2 [Sesamum indicum] Length = 170 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL+IP+ VASE+TFSAG RV+D++R+SL D Sbjct: 96 DILAIPITTVASEATFSAGSRVIDKYRASLTSD 128 Score = 38.1 bits (87), Expect(2) = 3e-08 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +3 Query: 84 AL*SPTVQALICTGDWLRAEYRIKKSMIADEDSMQ-EVSLETEV 212 +L S TVQ L+C GDWLR + +KK ++D+ ++ +SL+ +V Sbjct: 124 SLTSDTVQVLMCGGDWLRKRFGVKKKSLSDKKTIYVNLSLDGDV 167 >XP_019158453.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 131 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL++P+ +VASESTFSAGGRV+D++R+SL + Sbjct: 64 DILAVPISSVASESTFSAGGRVIDEYRASLNEE 96 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLE 203 +++ALIC GDWLR +Y +KK D QE+ L+ Sbjct: 97 SIEALICGGDWLRNKYGLKKKQKGD-SGQQEIMLK 130 >GAU36100.1 hypothetical protein TSUD_277110 [Trifolium subterraneum] Length = 521 Score = 51.2 bits (121), Expect(2) = 4e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 D+L+IP+ VASESTFSAGGRV+D FR+SL P Sbjct: 454 DVLAIPISTVASESTFSAGGRVIDSFRASLDP 485 Score = 33.5 bits (75), Expect(2) = 4e-08 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLETEVLM 218 TV++LIC GDWLR + IK ++ +++V +E E+L+ Sbjct: 487 TVESLICGGDWLRVLHGIK-----NKPKVKQVPIEIELLL 521 >XP_015964988.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 400 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKP 97 D+L+IP+ VASESTFSAGGRV+D FRSSL P Sbjct: 333 DVLAIPISTVASESTFSAGGRVIDTFRSSLSP 364 Score = 32.0 bits (71), Expect(2) = 5e-08 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIK-KSMIADEDSMQEVSL 200 T + LIC GDWLR Y ++ KS + EDS E++L Sbjct: 366 TAETLICGGDWLRVFYGLRNKSKV--EDSSVEITL 398 >KRG90264.1 hypothetical protein GLYMA_20G078600 [Glycine max] Length = 331 Score = 48.9 bits (115), Expect(2) = 5e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 2 DILSIPVINVASESTFSAGGRVLDQFRSSLKPD 100 DIL+IP+ VASESTFSAGGRV+D++RS L + Sbjct: 247 DILAIPISTVASESTFSAGGRVIDEYRSKLNEE 279 Score = 35.4 bits (80), Expect(2) = 5e-08 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 99 TVQALICTGDWLRAEYRIKKSMIADEDSMQEVSLETE 209 +++ALIC GDWLR Y +KK+ A + S++ E Sbjct: 280 SIEALICGGDWLRHNYNLKKNSKAPHTPVSPSSIKHE 316