BLASTX nr result
ID: Panax25_contig00019037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00019037 (636 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017702195.1 PREDICTED: zinc finger BED domain-containing prot... 78 5e-15 XP_008780286.1 PREDICTED: zinc finger BED domain-containing prot... 77 8e-14 XP_017250711.1 PREDICTED: zinc finger BED domain-containing prot... 78 4e-13 XP_008779896.1 PREDICTED: zinc finger BED domain-containing prot... 74 1e-12 XP_008779743.1 PREDICTED: zinc finger BED domain-containing prot... 73 1e-11 XP_015874362.1 PREDICTED: zinc finger BED domain-containing prot... 67 4e-10 XP_015950046.1 PREDICTED: zinc finger BED domain-containing prot... 69 4e-10 XP_011093470.1 PREDICTED: zinc finger BED domain-containing prot... 65 5e-10 XP_011093469.1 PREDICTED: zinc finger BED domain-containing prot... 66 5e-10 KMT03829.1 hypothetical protein BVRB_8g189720 [Beta vulgaris sub... 69 6e-10 XP_012575095.1 PREDICTED: zinc finger BED domain-containing prot... 68 7e-10 XP_012568925.1 PREDICTED: zinc finger BED domain-containing prot... 68 7e-10 XP_016166020.1 PREDICTED: zinc finger BED domain-containing prot... 68 8e-10 XP_015962322.1 PREDICTED: zinc finger BED domain-containing prot... 67 8e-10 XP_012575474.1 PREDICTED: zinc finger BED domain-containing prot... 68 1e-09 XP_019158383.1 PREDICTED: zinc finger BED domain-containing prot... 64 1e-09 XP_015892766.1 PREDICTED: zinc finger BED domain-containing prot... 65 1e-09 KNA13392.1 hypothetical protein SOVF_117470 [Spinacia oleracea] 67 1e-09 XP_018859165.1 PREDICTED: zinc finger BED domain-containing prot... 66 2e-09 XP_019172109.1 PREDICTED: zinc finger BED domain-containing prot... 67 2e-09 >XP_017702195.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 131 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDED 452 +TTVASE+ FSAGGRV DQ+RSSLKP+TVQAL CTGDWL E +++S VDE+ Sbjct: 64 ITTVASEAAFSAGGRVLDQYRSSLKPETVQALICTGDWLRQELGLEQSSNVDEE 117 >XP_008780286.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 76.6 bits (187), Expect = 8e-14 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDED 452 +TTVASE+ FSAGGRV DQ+RSSLKP+TV+AL CTGDWL E +++S VDE+ Sbjct: 131 ITTVASEAAFSAGGRVLDQYRSSLKPETVEALICTGDWLHHELGLEQSSNVDEE 184 >XP_017250711.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 710 Score = 77.8 bits (190), Expect = 4e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKI 479 +TTVASESTFSAGGRV DQ+RSSLKP+TV+AL CT DWL A+YKI Sbjct: 638 ITTVASESTFSAGGRVLDQYRSSLKPETVEALICTSDWLRADYKI 682 >XP_008779896.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDED 452 +TTVASE+ FSAGGRV DQ+ SSLKP+TV+AL CTGDWL E +++S VDE+ Sbjct: 131 ITTVASEAAFSAGGRVLDQYCSSLKPETVEALICTGDWLRHELGLEQSSNVDEE 184 >XP_008779743.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 663 Score = 73.2 bits (178), Expect = 1e-11 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDED 452 +TTVASE+ FSAGGRV DQ+RSSLKP TVQAL CT DWL E +++S VDE+ Sbjct: 599 ITTVASEAAFSAGGRVLDQYRSSLKPATVQALICTRDWLHHELGLEQSSNVDEE 652 >XP_015874362.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Ziziphus jujuba] Length = 184 Score = 66.6 bits (161), Expect = 4e-10 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDEDLETEVL 434 ++TVASES FS GGRV DQFRSSLKP TV+A+ CT DWL + + ++ + EDL +VL Sbjct: 106 ISTVASESAFSIGGRVLDQFRSSLKPSTVEAIVCTRDWLFGQREKFEAQL--EDLTEDVL 163 >XP_015950046.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis duranensis] Length = 561 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIK-KSMIVDEDLE 446 ++TVASESTFSAGGRV D FRSSL P TV+AL C GDWL Y ++ KS + D +E Sbjct: 500 ISTVASESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 556 >XP_011093470.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X3 [Sesamum indicum] Length = 152 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIV 461 +TTVASE+TFSAG RV D++R+SL DTVQ L C GDWL + +KK +V Sbjct: 102 ITTVASEATFSAGSRVIDKYRASLTSDTVQVLMCGGDWLRKRFGVKKKSLV 152 >XP_011093469.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X2 [Sesamum indicum] Length = 170 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDE 455 +TTVASE+TFSAG RV D++R+SL DTVQ L C GDWL + +KK + D+ Sbjct: 102 ITTVASEATFSAGSRVIDKYRASLTSDTVQVLMCGGDWLRKRFGVKKKSLSDK 154 >KMT03829.1 hypothetical protein BVRB_8g189720 [Beta vulgaris subsp. vulgaris] Length = 648 Score = 68.6 bits (166), Expect = 6e-10 Identities = 35/62 (56%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIK-KSMIVDEDLETEV 437 +TTVASE+TFSAG RV D +RSSL P+TVQ L CTGDW + + IK K+ VDE E+ Sbjct: 584 ITTVASEATFSAGSRVIDPYRSSLLPETVQMLICTGDWCRSTFGIKRKNKFVDEYEPKEI 643 Query: 436 LM 431 ++ Sbjct: 644 II 645 >XP_012575095.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 351 Score = 67.8 bits (164), Expect = 7e-10 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDE 455 ++TVASESTFSAGGRV D+FRS L ++V+AL C GDW +Y +KK VD+ Sbjct: 290 ISTVASESTFSAGGRVIDEFRSKLNEESVEALICGGDWFRHKYNVKKKSKVDK 342 >XP_012568925.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 352 Score = 67.8 bits (164), Expect = 7e-10 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDE 455 ++TVASESTFSAGGRV D+FRS L ++V+AL C GDW +Y +KK VD+ Sbjct: 291 ISTVASESTFSAGGRVIDEFRSKLNEESVEALICGGDWFRHKYNVKKKSKVDK 343 >XP_016166020.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis ipaensis] Length = 724 Score = 68.2 bits (165), Expect = 8e-10 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIK-KSMIVDEDLE 446 + TVASESTFSAGGRV D FRSSL P TV+AL C GDWL Y ++ KS + D +E Sbjct: 663 ILTVASESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 719 >XP_015962322.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 314 Score = 67.4 bits (163), Expect = 8e-10 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIK-KSMIVDEDLE 446 ++TV SESTFSAGGRV D FRSSL P TV+AL C GDWL Y ++ KS + D +E Sbjct: 253 ISTVVSESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 309 >XP_012575474.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 558 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDE 455 ++TVASESTFSAGGRV D+FRS L ++V+AL C GDW +Y +KK VD+ Sbjct: 497 ISTVASESTFSAGGRVIDEFRSKLNEESVEALICGGDWFRHKYNVKKKSKVDK 549 >XP_019158383.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 131 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDEDLETEVL 434 +++VASESTFSAGGRV D++R+SL ++++AL C GDWL +Y +KK D E +L Sbjct: 70 ISSVASESTFSAGGRVIDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSGQEEIML 129 >XP_015892766.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Ziziphus jujuba] XP_015869942.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Ziziphus jujuba] Length = 189 Score = 65.1 bits (157), Expect = 1e-09 Identities = 33/60 (55%), Positives = 44/60 (73%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDEDLETEVL 434 ++TVASES FS GG+V DQFRSSLKP TV+A+ CT DWL + + ++ + EDL +VL Sbjct: 111 ISTVASESAFSIGGQVLDQFRSSLKPSTVEAIVCTRDWLFGQREKFQAQL--EDLTEDVL 168 >KNA13392.1 hypothetical protein SOVF_117470 [Spinacia oleracea] Length = 708 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/62 (50%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKI-KKSMIVDEDLETEV 437 +TTVASE+TFSAG RV D +R+SL P+TVQ L C GDW + Y + +K+ ++ED E+ Sbjct: 644 ITTVASEATFSAGSRVIDSYRASLLPETVQMLICVGDWCRSRYGVQRKNKSIEEDEPKEI 703 Query: 436 LM 431 ++ Sbjct: 704 IL 705 >XP_018859165.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Juglans regia] Length = 248 Score = 65.9 bits (159), Expect = 2e-09 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*A-EYKIKKSMIVDEDLETEV 437 V+TVASESTFS GGR+ DQFRS+LK D V+AL CT DWL E +I++ + +DE TE Sbjct: 166 VSTVASESTFSVGGRIIDQFRSTLKADIVEALVCTRDWLYGEEQEIQEEVKLDE--LTED 223 Query: 436 LMQ*RN 419 +M+ N Sbjct: 224 VMELEN 229 >XP_019172109.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 635 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = -3 Query: 613 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALTCTGDWL*AEYKIKKSMIVDEDLET 443 +TTVASESTFSAGGRV D +R+SL DTVQ L C DWL Y IK+ ED++T Sbjct: 575 ITTVASESTFSAGGRVIDTYRASLGTDTVQMLLCGSDWLRNLYDIKRKPKFTEDVKT 631