BLASTX nr result
ID: Panax25_contig00018860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018860 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255288.1 PREDICTED: WAT1-related protein At5g07050-like [D... 57 1e-06 >XP_017255288.1 PREDICTED: WAT1-related protein At5g07050-like [Daucus carota subsp. sativus] KZM92036.1 hypothetical protein DCAR_020599 [Daucus carota subsp. sativus] Length = 408 Score = 57.0 bits (136), Expect = 1e-06 Identities = 35/71 (49%), Positives = 40/71 (56%), Gaps = 3/71 (4%) Frame = +2 Query: 2 KYKEYKENEAESILEPVKGNTTGNNVMMIGDIEANDIE-MQKNEXXXXXXXXXXXXXXXG 178 KYKEYKE EAE LEPVK N +MMI DIEAN+ + MQKNE Sbjct: 336 KYKEYKEKEAEEFLEPVKDVNNNNAMMMIKDIEANNEDVMQKNETRIVMSPAAFAISAPI 395 Query: 179 P--PMIAMETP 205 P PM+A+E P Sbjct: 396 PTLPMLAVEAP 406