BLASTX nr result
ID: Panax25_contig00018788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018788 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219433.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_009801174.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_006359586.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_004248551.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_019257114.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_016501079.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_009591077.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_016545173.1 PREDICTED: cationic amino acid transporter 9, chl... 79 1e-13 XP_015056284.1 PREDICTED: cationic amino acid transporter 9, chl... 78 3e-13 XP_019186037.1 PREDICTED: cationic amino acid transporter 9, chl... 74 5e-12 XP_011089716.1 PREDICTED: cationic amino acid transporter 9, chl... 73 1e-11 XP_012831484.1 PREDICTED: cationic amino acid transporter 9, chl... 73 2e-11 EYU42360.1 hypothetical protein MIMGU_mgv1a003383mg [Erythranthe... 73 2e-11 XP_011093273.1 PREDICTED: cationic amino acid transporter 9, chl... 71 6e-11 KZV41590.1 cationic amino acid transporter 9, chloroplastic-like... 70 1e-10 KVH87789.1 Amino acid/polyamine transporter I [Cynara cardunculu... 70 1e-10 KVH91238.1 Amino acid/polyamine transporter I [Cynara cardunculu... 70 1e-10 EPS68813.1 cationic amino acid transporter, partial [Genlisea au... 69 5e-10 XP_010661384.1 PREDICTED: cationic amino acid transporter 9, chl... 67 2e-09 XP_002272634.3 PREDICTED: cationic amino acid transporter 9, chl... 67 2e-09 >XP_017219433.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Daucus carota subsp. sativus] KZM87970.1 hypothetical protein DCAR_025071 [Daucus carota subsp. sativus] Length = 558 Score = 79.3 bits (194), Expect = 1e-13 Identities = 37/46 (80%), Positives = 46/46 (100%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEEMFGA+SFNILAP+LLVLLT+ILC+GVGESS++NSLMT++KV Sbjct: 166 HGSEEMFGAISFNILAPVLLVLLTLILCQGVGESSMVNSLMTITKV 211 >XP_009801174.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Nicotiana sylvestris] XP_016505041.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Nicotiana tabacum] Length = 568 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 174 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 219 >XP_006359586.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Solanum tuberosum] Length = 569 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 176 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 221 >XP_004248551.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Solanum lycopersicum] Length = 569 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 176 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 221 >XP_019257114.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Nicotiana attenuata] OIS96059.1 cationic amino acid transporter 9, chloroplastic [Nicotiana attenuata] Length = 571 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 177 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 222 >XP_016501079.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Nicotiana tabacum] XP_016501080.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Nicotiana tabacum] Length = 571 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 177 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 222 >XP_009591077.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Nicotiana tomentosiformis] XP_009591078.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Nicotiana tomentosiformis] Length = 571 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 177 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 222 >XP_016545173.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Capsicum annuum] Length = 578 Score = 79.0 bits (193), Expect = 1e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MTV+KV Sbjct: 185 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTVTKV 230 >XP_015056284.1 PREDICTED: cationic amino acid transporter 9, chloroplastic [Solanum pennellii] Length = 569 Score = 77.8 bits (190), Expect = 3e-13 Identities = 36/46 (78%), Positives = 45/46 (97%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE++GA SFN+LAPILLVLLT++LCRGVGESSILNS+MT++KV Sbjct: 176 HGSEEIYGAFSFNLLAPILLVLLTIVLCRGVGESSILNSVMTMTKV 221 >XP_019186037.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Ipomoea nil] Length = 570 Score = 74.3 bits (181), Expect = 5e-12 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GSEE GA SFN+LAP+LL++LT++LCRGVGESS+LNS+MTV+KV Sbjct: 175 HGSEEYLGAFSFNLLAPVLLIVLTIVLCRGVGESSMLNSIMTVTKV 220 >XP_011089716.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] XP_011089725.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] Length = 560 Score = 73.2 bits (178), Expect = 1e-11 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+ GALS NILAPI+LVLLTV+LCRGVGESSILNS+MTV+K+ Sbjct: 181 EEVLGALSINILAPIILVLLTVVLCRGVGESSILNSIMTVTKI 223 >XP_012831484.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Erythranthe guttata] EYU42359.1 hypothetical protein MIMGU_mgv1a003383mg [Erythranthe guttata] Length = 564 Score = 72.8 bits (177), Expect = 2e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+FG S NILAPILL+LLTV+LCRGVGESSILNS+MTV+KV Sbjct: 173 EEVFGPFSINILAPILLILLTVVLCRGVGESSILNSIMTVTKV 215 >EYU42360.1 hypothetical protein MIMGU_mgv1a003383mg [Erythranthe guttata] Length = 588 Score = 72.8 bits (177), Expect = 2e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+FG S NILAPILL+LLTV+LCRGVGESSILNS+MTV+KV Sbjct: 173 EEVFGPFSINILAPILLILLTVVLCRGVGESSILNSIMTVTKV 215 >XP_011093273.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] XP_011093274.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] XP_011093275.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] XP_011093276.1 PREDICTED: cationic amino acid transporter 9, chloroplastic-like [Sesamum indicum] Length = 571 Score = 71.2 bits (173), Expect = 6e-11 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+ GALS NILAPILLVLLTV+LC GVGESSILNS+MTV+KV Sbjct: 180 EEVLGALSINILAPILLVLLTVVLCWGVGESSILNSIMTVTKV 222 >KZV41590.1 cationic amino acid transporter 9, chloroplastic-like [Dorcoceras hygrometricum] Length = 480 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+ GALS NILAPILL LLT ILCRGVGESS+LNS+MTV+KV Sbjct: 168 EEVLGALSINILAPILLALLTFILCRGVGESSVLNSVMTVTKV 210 >KVH87789.1 Amino acid/polyamine transporter I [Cynara cardunculus var. scolymus] Length = 615 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +G +++FG LS NILAPILLV LT+ILCRGVGESS+LN++MT++KV Sbjct: 167 HGGDDIFGFLSINILAPILLVFLTIILCRGVGESSLLNTVMTITKV 212 >KVH91238.1 Amino acid/polyamine transporter I [Cynara cardunculus var. scolymus] Length = 549 Score = 70.1 bits (170), Expect = 1e-10 Identities = 30/46 (65%), Positives = 43/46 (93%) Frame = -2 Query: 274 NGSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 +GS+E+FG +S N+LAP+LLVLLT+ILCRGVGESS++N++MT +K+ Sbjct: 166 HGSKEIFGFISINLLAPVLLVLLTIILCRGVGESSLVNTIMTTTKI 211 >EPS68813.1 cationic amino acid transporter, partial [Genlisea aurea] Length = 550 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 265 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 EE+ GALS NILAPI+L+LLT++LC GVGESSILNS+MTV+KV Sbjct: 172 EELMGALSINILAPIILLLLTLVLCWGVGESSILNSIMTVTKV 214 >XP_010661384.1 PREDICTED: cationic amino acid transporter 9, chloroplastic isoform X2 [Vitis vinifera] Length = 541 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 271 GSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 G E + GALS NILAPILLVLLT+ILCRGVGESS +N MTV+KV Sbjct: 207 GEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMTVTKV 251 >XP_002272634.3 PREDICTED: cationic amino acid transporter 9, chloroplastic isoform X1 [Vitis vinifera] CBI16645.3 unnamed protein product, partial [Vitis vinifera] Length = 600 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 271 GSEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 137 G E + GALS NILAPILLVLLT+ILCRGVGESS +N MTV+KV Sbjct: 207 GEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMTVTKV 251