BLASTX nr result
ID: Panax25_contig00018706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018706 (600 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019226716.1 PREDICTED: mitochondrial import receptor subunit ... 93 5e-20 XP_009620342.1 PREDICTED: mitochondrial import receptor subunit ... 93 5e-20 XP_009790058.1 PREDICTED: mitochondrial import receptor subunit ... 91 3e-19 XP_002509514.1 PREDICTED: mitochondrial import receptor subunit ... 91 4e-19 XP_009783275.1 PREDICTED: mitochondrial import receptor subunit ... 90 5e-19 XP_009601172.1 PREDICTED: mitochondrial import receptor subunit ... 90 5e-19 XP_019239067.1 PREDICTED: mitochondrial import receptor subunit ... 90 5e-19 XP_002269795.1 PREDICTED: mitochondrial import receptor subunit ... 90 7e-19 KZV47559.1 hypothetical protein F511_32223 [Dorcoceras hygrometr... 89 1e-18 XP_019184131.1 PREDICTED: mitochondrial import receptor subunit ... 89 1e-18 XP_010248998.1 PREDICTED: mitochondrial import receptor subunit ... 89 1e-18 XP_004233293.1 PREDICTED: mitochondrial import receptor subunit ... 89 2e-18 XP_010250723.1 PREDICTED: mitochondrial import receptor subunit ... 89 2e-18 XP_015871157.1 PREDICTED: mitochondrial import receptor subunit ... 88 2e-18 XP_016559146.1 PREDICTED: mitochondrial import receptor subunit ... 88 4e-18 XP_015900869.1 PREDICTED: mitochondrial import receptor subunit ... 88 4e-18 XP_019428099.1 PREDICTED: mitochondrial import receptor subunit ... 88 5e-18 XP_014524225.1 PREDICTED: mitochondrial import receptor subunit ... 87 6e-18 GAV64273.1 TOM20_plant domain-containing protein, partial [Cepha... 87 8e-18 XP_017245908.1 PREDICTED: mitochondrial import receptor subunit ... 87 8e-18 >XP_019226716.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana attenuata] OIT06075.1 mitochondrial import receptor subunit tom20 [Nicotiana attenuata] Length = 201 Score = 92.8 bits (229), Expect = 5e-20 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G GPSTS S K K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSNV PPPP Sbjct: 149 GPGPSTSTSTKGSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNVPPPPP 199 >XP_009620342.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana tomentosiformis] XP_016457148.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana tabacum] Length = 201 Score = 92.8 bits (229), Expect = 5e-20 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G GPSTS S K K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSNV PPPP Sbjct: 149 GPGPSTSTSTKGSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNVPPPPP 199 >XP_009790058.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana sylvestris] XP_016487017.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana tabacum] Length = 203 Score = 90.9 bits (224), Expect = 3e-19 Identities = 42/51 (82%), Positives = 43/51 (84%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G GPS S S K K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSNV PPPP Sbjct: 149 GPGPSASTSTKGSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNVPPPPP 199 >XP_002509514.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Ricinus communis] EEF50901.1 Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] Length = 205 Score = 90.5 bits (223), Expect = 4e-19 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +2 Query: 5 SGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 SGPSTS SAK+ K KK SDLKYDIFGW+ILAVGIVAW+GFAKS + PPPPR Sbjct: 155 SGPSTSSSAKTSKKKKDSDLKYDIFGWVILAVGIVAWIGFAKSQMPPPPPR 205 >XP_009783275.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Nicotiana sylvestris] XP_016439571.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Nicotiana tabacum] Length = 202 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G PSTS S KS K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 150 GPEPSTSTSTKSSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 200 >XP_009601172.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Nicotiana tomentosiformis] XP_016438094.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nicotiana tabacum] Length = 202 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G PSTS S KS K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 150 GPEPSTSTSTKSSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 200 >XP_019239067.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Nicotiana attenuata] OIT21305.1 mitochondrial import receptor subunit tom20 [Nicotiana attenuata] Length = 203 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G PSTS S KS K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 150 GPEPSTSTSTKSSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 200 >XP_002269795.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Vitis vinifera] CBI21351.3 unnamed protein product, partial [Vitis vinifera] Length = 201 Score = 89.7 bits (221), Expect = 7e-19 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G+G STS K+ K KKSSDLKYDIFGWIILAVGIVAWVGFAKS+V PPPPR Sbjct: 150 GAGSSTSTGTKTSKKKKSSDLKYDIFGWIILAVGIVAWVGFAKSHVPPPPPR 201 >KZV47559.1 hypothetical protein F511_32223 [Dorcoceras hygrometricum] Length = 201 Score = 89.0 bits (219), Expect = 1e-18 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G GPS+S S K K K+SDLKYD+FGWIILAVGIVAWVGFAKSNV PPPPR Sbjct: 150 GPGPSSSTSTKQTKKAKTSDLKYDVFGWIILAVGIVAWVGFAKSNVPPPPPR 201 >XP_019184131.1 PREDICTED: mitochondrial import receptor subunit TOM20-like isoform X2 [Ipomoea nil] Length = 203 Score = 89.0 bits (219), Expect = 1e-18 Identities = 44/52 (84%), Positives = 45/52 (86%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G GPSTS S K+ K KKSSDLKYDIFGWIILAVGIVAWVGFAKS V PPPPR Sbjct: 153 GPGPSTSTSTKTAKNKKSSDLKYDIFGWIILAVGIVAWVGFAKSQV-PPPPR 203 >XP_010248998.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nelumbo nucifera] Length = 203 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/52 (82%), Positives = 44/52 (84%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G G STS SA S K KKSSDLKYDIFGWIILAVGIVAWVG AKS+V PPPPR Sbjct: 152 GGGSSTSSSANSSKKKKSSDLKYDIFGWIILAVGIVAWVGMAKSHVPPPPPR 203 >XP_004233293.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Solanum lycopersicum] XP_015066726.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Solanum pennellii] Length = 204 Score = 89.0 bits (219), Expect = 2e-18 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +2 Query: 11 PSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 PSTS S KS K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 153 PSTSTSTKSSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 200 >XP_010250723.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Nelumbo nucifera] Length = 204 Score = 88.6 bits (218), Expect = 2e-18 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 8 GPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G STS SAKS K KKSSDLKYDIFGWIILAVGIVAWVG AKS+V PPPPR Sbjct: 155 GSSTSSSAKSSKKKKSSDLKYDIFGWIILAVGIVAWVGMAKSHVPPPPPR 204 >XP_015871157.1 PREDICTED: mitochondrial import receptor subunit TOM20-like, partial [Ziziphus jujuba] Length = 180 Score = 87.8 bits (216), Expect = 2e-18 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G+GP+TS +AKS K KK+SDLKYDI GWIILAVGIVAW+G AKSN+ PPPP Sbjct: 128 GAGPTTSFNAKSSKSKKNSDLKYDICGWIILAVGIVAWIGMAKSNIPPPPP 178 >XP_016559146.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Capsicum annuum] Length = 205 Score = 87.8 bits (216), Expect = 4e-18 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +2 Query: 11 PSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 PSTS S K+ K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 154 PSTSTSTKTSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 201 >XP_015900869.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Ziziphus jujuba] XP_015870759.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Ziziphus jujuba] Length = 205 Score = 87.8 bits (216), Expect = 4e-18 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 G+GP+TS +AKS K KK+SDLKYDI GWIILAVGIVAW+G AKSN+ PPPP Sbjct: 153 GAGPTTSFNAKSSKSKKNSDLKYDICGWIILAVGIVAWIGMAKSNIPPPPP 203 >XP_019428099.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Lupinus angustifolius] OIV90106.1 hypothetical protein TanjilG_01560 [Lupinus angustifolius] Length = 208 Score = 87.8 bits (216), Expect = 5e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 5 SGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 +GPSTS K+ K KKSSDLKYDIFGW+ILAVGIVAWVGFAKSN+ PPPP Sbjct: 155 AGPSTSSGTKTQKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPP 204 >XP_014524225.1 PREDICTED: mitochondrial import receptor subunit TOM20-like [Vigna radiata var. radiata] Length = 204 Score = 87.4 bits (215), Expect = 6e-18 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +2 Query: 5 SGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 +G STS + K+ K KKSSDLKYDIFGWIILAVGIVAWVGFAKSN+ PPPPR Sbjct: 154 AGSSTSSATKTQKKKKSSDLKYDIFGWIILAVGIVAWVGFAKSNLPPPPPR 204 >GAV64273.1 TOM20_plant domain-containing protein, partial [Cephalotus follicularis] Length = 201 Score = 87.0 bits (214), Expect = 8e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 5 SGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPP 154 +GPSTS SAKS K KK+SDLKYDIFGW+ILAVGIV WVGF KS+V PPPP Sbjct: 152 AGPSTSSSAKSPKKKKNSDLKYDIFGWVILAVGIVVWVGFTKSHVPPPPP 201 >XP_017245908.1 PREDICTED: mitochondrial import receptor subunit TOM20 [Daucus carota subsp. sativus] KZM97537.1 hypothetical protein DCAR_015101 [Daucus carota subsp. sativus] Length = 203 Score = 87.0 bits (214), Expect = 8e-18 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = +2 Query: 2 GSGPSTSISAKSGKPKKSSDLKYDIFGWIILAVGIVAWVGFAKSNVRPPPPR 157 G+GPSTS SAK G KKSSDLKYDIFGW+IL V IVAW GFAKSN+ PPPR Sbjct: 152 GTGPSTSTSAKVGNAKKSSDLKYDIFGWVILVVAIVAWTGFAKSNMPSPPPR 203