BLASTX nr result
ID: Panax25_contig00018662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018662 (734 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008457241.1 PREDICTED: small EDRK-rich factor 2 [Cucumis melo] 71 1e-12 XP_004138960.1 PREDICTED: small EDRK-rich factor 2 [Cucumis sati... 71 1e-12 XP_017216660.1 PREDICTED: small EDRK-rich factor 2-like [Daucus ... 69 4e-12 XP_006373059.1 hypothetical protein POPTR_0017s08260g [Populus t... 69 6e-12 XP_011073783.1 PREDICTED: small EDRK-rich factor 2 [Sesamum indi... 67 2e-11 XP_006602502.1 PREDICTED: small EDRK-rich factor 2 [Glycine max]... 66 6e-11 XP_019250558.1 PREDICTED: small EDRK-rich factor 2-like [Nicotia... 66 8e-11 XP_009772050.1 PREDICTED: small EDRK-rich factor 2-like [Nicotia... 66 8e-11 XP_007223554.1 hypothetical protein PRUPE_ppa014532mg [Prunus pe... 65 1e-10 XP_019055331.1 PREDICTED: small EDRK-rich factor 2-like [Nelumbo... 65 1e-10 XP_015574059.1 PREDICTED: putative SERF-like protein [Ricinus co... 65 2e-10 XP_019459300.1 PREDICTED: small EDRK-rich factor 2 [Lupinus angu... 65 2e-10 XP_013730354.1 PREDICTED: small EDRK-rich factor 2-like [Brassic... 65 2e-10 XP_017969296.1 PREDICTED: putative SERF-like protein [Theobroma ... 65 3e-10 XP_018436682.1 PREDICTED: small EDRK-rich factor 2 [Raphanus sat... 65 3e-10 XP_017625562.1 PREDICTED: small EDRK-rich factor 2-like [Gossypi... 65 3e-10 XP_016746477.1 PREDICTED: small EDRK-rich factor 2-like isoform ... 65 3e-10 XP_020107604.1 small EDRK-rich factor 2-like [Ananas comosus] 64 3e-10 XP_006599192.1 PREDICTED: putative SERF-like protein [Glycine ma... 64 3e-10 NP_189052.2 Uncharacterized protein family SERF [Arabidopsis tha... 64 3e-10 >XP_008457241.1 PREDICTED: small EDRK-rich factor 2 [Cucumis melo] Length = 68 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQREKDRERA ARNGGK K KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARNGGKGKTKDDGLTPEQRRERD 38 >XP_004138960.1 PREDICTED: small EDRK-rich factor 2 [Cucumis sativus] KGN61475.1 hypothetical protein Csa_2G138790 [Cucumis sativus] Length = 68 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQREKDRERA ARNGGK K KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERD 38 >XP_017216660.1 PREDICTED: small EDRK-rich factor 2-like [Daucus carota subsp. sativus] Length = 64 Score = 69.3 bits (168), Expect = 4e-12 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQREKDRERANAR GGK K KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERANARAGGKAKGKDDGLTPEQRRERD 38 >XP_006373059.1 hypothetical protein POPTR_0017s08260g [Populus trichocarpa] ABK93321.1 unknown [Populus trichocarpa] ERP50856.1 hypothetical protein POPTR_0017s08260g [Populus trichocarpa] Length = 68 Score = 68.9 bits (167), Expect = 6e-12 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 M RGNQREKDRERA ARNGGK K KDDGLTPEQRRERD Sbjct: 1 MARGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERD 38 >XP_011073783.1 PREDICTED: small EDRK-rich factor 2 [Sesamum indicum] Length = 66 Score = 67.4 bits (163), Expect = 2e-11 Identities = 33/38 (86%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQRE+DRERA ARN GK K KDDGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERAQARNSGKGKNKDDGLTPEQRRERD 38 >XP_006602502.1 PREDICTED: small EDRK-rich factor 2 [Glycine max] KRG99692.1 hypothetical protein GLYMA_18G164200 [Glycine max] Length = 64 Score = 66.2 bits (160), Expect = 6e-11 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQR++DRERA AR GGK K KDDGLTPEQRRERD Sbjct: 1 MTRGNQRDRDRERAQARTGGKGKQKDDGLTPEQRRERD 38 >XP_019250558.1 PREDICTED: small EDRK-rich factor 2-like [Nicotiana attenuata] Length = 66 Score = 65.9 bits (159), Expect = 8e-11 Identities = 33/38 (86%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNG-GKNKKDDGLTPEQRRERD 421 MTRGNQREKDRERA AR G GK KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARTGKGKKGKDDGLTPEQRRERD 38 >XP_009772050.1 PREDICTED: small EDRK-rich factor 2-like [Nicotiana sylvestris] XP_016434064.1 PREDICTED: small EDRK-rich factor 2-like [Nicotiana tabacum] Length = 66 Score = 65.9 bits (159), Expect = 8e-11 Identities = 33/38 (86%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNG-GKNKKDDGLTPEQRRERD 421 MTRGNQREKDRERA AR G GK KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARTGKGKKGKDDGLTPEQRRERD 38 >XP_007223554.1 hypothetical protein PRUPE_ppa014532mg [Prunus persica] XP_008224509.1 PREDICTED: small EDRK-rich factor 2 [Prunus mume] ONI26188.1 hypothetical protein PRUPE_1G008500 [Prunus persica] Length = 64 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNKKDDGLTPEQRRERD 421 MTRGNQREKDRERA AR G KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARGGKGKNKDDGLTPEQRRERD 37 >XP_019055331.1 PREDICTED: small EDRK-rich factor 2-like [Nelumbo nucifera] Length = 68 Score = 65.5 bits (158), Expect = 1e-10 Identities = 33/38 (86%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRGNQRE+DRERA ARNG K K KDDGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERALARNGQKTKGKDDGLTPEQRRERD 38 >XP_015574059.1 PREDICTED: putative SERF-like protein [Ricinus communis] Length = 69 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK--KDDGLTPEQRRERD 421 MTRGNQRE+DRERA AR GGK KDDGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERAQARTGGKGSKGKDDGLTPEQRRERD 39 >XP_019459300.1 PREDICTED: small EDRK-rich factor 2 [Lupinus angustifolius] Length = 65 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNKKDDGLTPEQRRERD 421 MTRGNQREKDRERA ARN KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQARNAKGKLKDDGLTPEQRRERD 37 >XP_013730354.1 PREDICTED: small EDRK-rich factor 2-like [Brassica napus] Length = 68 Score = 64.7 bits (156), Expect = 2e-10 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRG+QRE+DRERA AR GGK K KDDGLTPEQRRERD Sbjct: 1 MTRGSQRERDRERAQARAGGKGKTKDDGLTPEQRRERD 38 >XP_017969296.1 PREDICTED: putative SERF-like protein [Theobroma cacao] EOX93916.1 Uncharacterized protein TCM_002918 isoform 1 [Theobroma cacao] Length = 71 Score = 64.7 bits (156), Expect = 3e-10 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK--KDDGLTPEQRRERD 421 MTRGNQRE+DRERA AR G K K KDDGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERAQARTGNKGKSVKDDGLTPEQRRERD 39 >XP_018436682.1 PREDICTED: small EDRK-rich factor 2 [Raphanus sativus] Length = 72 Score = 64.7 bits (156), Expect = 3e-10 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRG+QRE+DRERA AR GGK K KDDGLTPEQRRERD Sbjct: 1 MTRGSQRERDRERAQARAGGKGKTKDDGLTPEQRRERD 38 >XP_017625562.1 PREDICTED: small EDRK-rich factor 2-like [Gossypium arboreum] XP_017625570.1 PREDICTED: small EDRK-rich factor 2-like [Gossypium arboreum] Length = 72 Score = 64.7 bits (156), Expect = 3e-10 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 3/40 (7%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK---KDDGLTPEQRRERD 421 MTRGNQREKDRERA +R+G K K KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQSRSGNKGKAGSKDDGLTPEQRRERD 40 >XP_016746477.1 PREDICTED: small EDRK-rich factor 2-like isoform X2 [Gossypium hirsutum] Length = 72 Score = 64.7 bits (156), Expect = 3e-10 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 3/40 (7%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK---KDDGLTPEQRRERD 421 MTRGNQREKDRERA +R+G K K KDDGLTPEQRRERD Sbjct: 1 MTRGNQREKDRERAQSRSGNKGKAGSKDDGLTPEQRRERD 40 >XP_020107604.1 small EDRK-rich factor 2-like [Ananas comosus] Length = 66 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNKKDDGLTPEQRRERD 421 MTRGNQRE+DRERA AR G KDDGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERAQARKAGGKGKDDGLTPEQRRERD 37 >XP_006599192.1 PREDICTED: putative SERF-like protein [Glycine max] KRH07556.1 hypothetical protein GLYMA_16G094600 [Glycine max] Length = 66 Score = 64.3 bits (155), Expect = 3e-10 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK--KDDGLTPEQRRERD 421 MTRGNQRE+DRERA AR GGK K K+DGLTPEQRRERD Sbjct: 1 MTRGNQRERDRERAQARAGGKTKQPKNDGLTPEQRRERD 39 >NP_189052.2 Uncharacterized protein family SERF [Arabidopsis thaliana] AAK44146.1 unknown protein [Arabidopsis thaliana] AAN13152.1 unknown protein [Arabidopsis thaliana] AEE76857.1 Uncharacterized protein family SERF [Arabidopsis thaliana] Length = 69 Score = 64.3 bits (155), Expect = 3e-10 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 531 MTRGNQREKDRERANARNGGKNK-KDDGLTPEQRRERD 421 MTRG+QRE+DRERA AR GGK K KDDGLTPEQRRERD Sbjct: 1 MTRGSQRERDRERALARTGGKGKNKDDGLTPEQRRERD 38