BLASTX nr result
ID: Panax25_contig00018512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018512 (818 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74704.1 hypothetical protein M569_00079, partial [Genlisea au... 59 1e-07 CDP57099.1 hypothetical protein BN969_27980 [Staphylococcus aure... 53 4e-06 >EPS74704.1 hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 454 IVLLFPQSYGVRHRFLNKIN-SVDCMMDSPEKHWRTCKRGALP 579 ++LLF QSYGVRHR ++I+ + MM+SPEK WR CKRGALP Sbjct: 43 VMLLFSQSYGVRHRLQDQISIDFEWMMESPEKPWRACKRGALP 85 >CDP57099.1 hypothetical protein BN969_27980 [Staphylococcus aureus subsp. aureus] Length = 37 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -2 Query: 727 MDYKYHITYKQYHSNRSK--SYDLGSWNIHLDKKLST 623 MDYK +IT KQY SNR K YD+GS NIHLDKKLST Sbjct: 1 MDYKSNITSKQYQSNRPKGYDYDVGSCNIHLDKKLST 37