BLASTX nr result
ID: Panax25_contig00018171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018171 (553 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH97834.1 hypothetical protein Ccrd_000030 [Cynara cardunculus ... 60 2e-08 XP_007223778.1 hypothetical protein PRUPE_ppa013147mg [Prunus pe... 59 4e-08 XP_008222190.1 PREDICTED: uncharacterized protein LOC103322091 [... 59 5e-08 ONI29946.1 hypothetical protein PRUPE_1G223700 [Prunus persica] 59 5e-08 ONI29943.1 hypothetical protein PRUPE_1G223700 [Prunus persica] 59 5e-08 ONI29945.1 hypothetical protein PRUPE_1G223700 [Prunus persica] 59 6e-08 XP_015894320.1 PREDICTED: uncharacterized protein LOC107428312 [... 59 6e-08 XP_017218542.1 PREDICTED: uncharacterized protein LOC108196005 [... 57 4e-07 KZM87538.1 hypothetical protein DCAR_024672 [Daucus carota subsp... 57 4e-07 XP_008350961.1 PREDICTED: uncharacterized protein LOC103414343 i... 57 5e-07 XP_009372257.1 PREDICTED: uncharacterized protein LOC103961440 [... 57 5e-07 XP_017182049.1 PREDICTED: uncharacterized protein LOC103414343 i... 57 9e-07 OMO60530.1 hypothetical protein CCACVL1_24074 [Corchorus capsula... 55 1e-06 KVI11268.1 hypothetical protein Ccrd_010324 [Cynara cardunculus ... 54 2e-06 GAV89566.1 IQ domain-containing protein/TIG domain-containing pr... 57 3e-06 XP_018807032.1 PREDICTED: uncharacterized protein LOC108980543 i... 54 3e-06 XP_008361850.1 PREDICTED: uncharacterized protein LOC103425536 [... 54 4e-06 XP_018807031.1 PREDICTED: uncharacterized protein LOC108980543 i... 54 5e-06 XP_009343138.1 PREDICTED: uncharacterized protein LOC103935112 [... 54 6e-06 ACH87180.1 unknown protein [Camellia sinensis] 53 8e-06 >KVH97834.1 hypothetical protein Ccrd_000030 [Cynara cardunculus var. scolymus] Length = 137 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QDQQSRVFYELSALILN+LRYPP+P+QFSD Sbjct: 15 QDQQSRVFYELSALILNLLRYPPTPIQFSD 44 >XP_007223778.1 hypothetical protein PRUPE_ppa013147mg [Prunus persica] ONI29944.1 hypothetical protein PRUPE_1G223700 [Prunus persica] Length = 137 Score = 59.3 bits (142), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSDH Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDH 38 >XP_008222190.1 PREDICTED: uncharacterized protein LOC103322091 [Prunus mume] Length = 139 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSDH Sbjct: 11 QDQQSRVFYELSALVLNLLRSPPTPIQFSDH 41 >ONI29946.1 hypothetical protein PRUPE_1G223700 [Prunus persica] Length = 140 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSDH Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDH 38 >ONI29943.1 hypothetical protein PRUPE_1G223700 [Prunus persica] Length = 143 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSDH Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDH 38 >ONI29945.1 hypothetical protein PRUPE_1G223700 [Prunus persica] Length = 148 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSDH Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDH 38 >XP_015894320.1 PREDICTED: uncharacterized protein LOC107428312 [Ziziphus jujuba] Length = 133 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LNILR PPSP+ FSDH Sbjct: 6 QDQQSRVFYELSALVLNILRSPPSPIPFSDH 36 >XP_017218542.1 PREDICTED: uncharacterized protein LOC108196005 [Daucus carota subsp. sativus] Length = 125 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVF+ELSALILNILR PP+P+ FSDH Sbjct: 5 QDQQSRVFHELSALILNILRSPPTPIHFSDH 35 >KZM87538.1 hypothetical protein DCAR_024672 [Daucus carota subsp. sativus] Length = 125 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVF+ELSALILNILR PP+P+ FSDH Sbjct: 5 QDQQSRVFHELSALILNILRSPPTPIHFSDH 35 >XP_008350961.1 PREDICTED: uncharacterized protein LOC103414343 isoform X2 [Malus domestica] Length = 139 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSD+ Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDN 38 >XP_009372257.1 PREDICTED: uncharacterized protein LOC103961440 [Pyrus x bretschneideri] Length = 142 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSD+ Sbjct: 10 QDQQSRVFYELSALVLNLLRSPPTPIQFSDN 40 >XP_017182049.1 PREDICTED: uncharacterized protein LOC103414343 isoform X1 [Malus domestica] Length = 176 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR PP+P+QFSD+ Sbjct: 8 QDQQSRVFYELSALVLNLLRSPPTPIQFSDN 38 >OMO60530.1 hypothetical protein CCACVL1_24074 [Corchorus capsularis] Length = 135 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QDQQSRVFYELSAL+LN+LR PP+PM FSD Sbjct: 12 QDQQSRVFYELSALVLNLLRSPPTPMPFSD 41 >KVI11268.1 hypothetical protein Ccrd_010324 [Cynara cardunculus var. scolymus] Length = 89 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QDQQSRV YELSA+ILN+LRYPP+ +QFSD Sbjct: 8 QDQQSRVLYELSAMILNLLRYPPTSIQFSD 37 >GAV89566.1 IQ domain-containing protein/TIG domain-containing protein/CG-1 domain-containing protein/Ank_2 domain-containing protein [Cephalotus follicularis] Length = 1079 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQ SRVFYELSA++LN+LR PPSPM FSDH Sbjct: 9 QDQSSRVFYELSAMVLNLLRSPPSPMPFSDH 39 >XP_018807032.1 PREDICTED: uncharacterized protein LOC108980543 isoform X2 [Juglans regia] Length = 139 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QD+QSR+FYELSAL+LNILR PPSP+ FSD Sbjct: 7 QDEQSRIFYELSALVLNILRSPPSPIPFSD 36 >XP_008361850.1 PREDICTED: uncharacterized protein LOC103425536 [Malus domestica] Length = 148 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRV YELSAL+LN+LR PP+P+QFSD+ Sbjct: 8 QDQQSRVLYELSALVLNLLRSPPTPIQFSDN 38 >XP_018807031.1 PREDICTED: uncharacterized protein LOC108980543 isoform X1 [Juglans regia] Length = 161 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QD+QSR+FYELSAL+LNILR PPSP+ FSD Sbjct: 7 QDEQSRIFYELSALVLNILRSPPSPIPFSD 36 >XP_009343138.1 PREDICTED: uncharacterized protein LOC103935112 [Pyrus x bretschneideri] Length = 134 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSDH 74 QDQQSRVFYELSAL+LN+LR P +P+QFSD+ Sbjct: 8 QDQQSRVFYELSALVLNLLRSPSTPIQFSDN 38 >ACH87180.1 unknown protein [Camellia sinensis] Length = 129 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 166 QDQQSRVFYELSALILNILRYPPSPMQFSD 77 QDQQSRVF ELSALILN+LR PP+P+QFSD Sbjct: 5 QDQQSRVFCELSALILNLLRSPPTPIQFSD 34