BLASTX nr result
ID: Panax25_contig00018104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00018104 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244786.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 94 4e-19 XP_009758316.1 PREDICTED: TPR repeat-containing thioredoxin TTL2... 78 5e-14 XP_016445441.1 PREDICTED: inactive TPR repeat-containing thiored... 78 1e-13 KVI07260.1 Tetratricopeptide-like helical [Cynara cardunculus va... 77 1e-13 CDP01039.1 unnamed protein product [Coffea canephora] 75 7e-13 XP_019152335.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 75 1e-12 XP_009627310.1 PREDICTED: inactive TPR repeat-containing thiored... 74 2e-12 XP_015060167.1 PREDICTED: small glutamine-rich tetratricopeptide... 72 4e-12 OIT06002.1 inactive tpr repeat-containing thioredoxin ttl3 [Nico... 73 6e-12 XP_019238407.1 PREDICTED: inactive TPR repeat-containing thiored... 73 6e-12 XP_016456821.1 PREDICTED: inactive TPR repeat-containing thiored... 73 6e-12 XP_011074174.1 PREDICTED: TPR repeat-containing thioredoxin TTL4... 68 3e-10 XP_019241150.1 PREDICTED: inactive TPR repeat-containing thiored... 64 5e-09 XP_016571551.1 PREDICTED: inactive TPR repeat-containing thiored... 62 4e-08 XP_010261271.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 61 6e-08 XP_011022777.1 PREDICTED: inactive TPR repeat-containing thiored... 59 3e-07 XP_010269225.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 59 3e-07 XP_016476276.1 PREDICTED: inactive TPR repeat-containing thiored... 59 4e-07 XP_009759360.1 PREDICTED: TPR repeat-containing thioredoxin TTL4... 59 5e-07 XP_002309983.2 hypothetical protein POPTR_0007s05640g, partial [... 58 7e-07 >XP_017244786.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Daucus carota subsp. sativus] KZM99907.1 hypothetical protein DCAR_012731 [Daucus carota subsp. sativus] Length = 703 Score = 93.6 bits (231), Expect = 4e-19 Identities = 51/88 (57%), Positives = 64/88 (72%), Gaps = 1/88 (1%) Frame = -2 Query: 263 DRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKST-SSGVLYRASSGNAMLLGHLG 87 ++ S S + YT+ L+KEPTFTESELSMRIAVRQKST + G+LYRASS N ML HLG Sbjct: 116 NKTSDSSRDQLPYTKWLKKEPTFTESELSMRIAVRQKSTPTGGILYRASSNNGMLPSHLG 175 Query: 86 NLKQPGGKNSTTSNIKTTMNYHATTVKR 3 NLKQ GG + S+ KT+ N H T++ + Sbjct: 176 NLKQQGG-GAKASSGKTSANSHVTSLSK 202 >XP_009758316.1 PREDICTED: TPR repeat-containing thioredoxin TTL2-like [Nicotiana sylvestris] Length = 316 Score = 77.8 bits (190), Expect = 5e-14 Identities = 42/88 (47%), Positives = 60/88 (68%) Frame = -2 Query: 296 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 117 S + S+ + R+S QV N+AYT++LR+EPTFT ++LSM I +KS ++G L R+S+ Sbjct: 120 SNKASSNFSSVSRIS--QVVNLAYTQKLRREPTFTSTDLSMTIFSHRKSRTNGTLNRSST 177 Query: 116 GNAMLLGHLGNLKQPGGKNSTTSNIKTT 33 GN L HLGNLK G +N +SNI T+ Sbjct: 178 GNVSKLSHLGNLKLQGNQN-PSSNINTS 204 >XP_016445441.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 526 Score = 77.8 bits (190), Expect = 1e-13 Identities = 42/88 (47%), Positives = 60/88 (68%) Frame = -2 Query: 296 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 117 S + S+ + R+S QV N+AYT++LR+EPTFT ++LSM I +KS ++G L R+S+ Sbjct: 120 SNKASSNFSSVSRIS--QVVNLAYTQKLRREPTFTSTDLSMTIFSHRKSRTNGTLNRSST 177 Query: 116 GNAMLLGHLGNLKQPGGKNSTTSNIKTT 33 GN L HLGNLK G +N +SNI T+ Sbjct: 178 GNVSKLSHLGNLKLQGNQN-PSSNINTS 204 >KVI07260.1 Tetratricopeptide-like helical [Cynara cardunculus var. scolymus] Length = 583 Score = 77.4 bits (189), Expect = 1e-13 Identities = 45/96 (46%), Positives = 63/96 (65%) Frame = -2 Query: 338 STNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVR 159 +T + + +PP + S KSA S SQVTN++YT++LRKEP+FT SELS+RI+VR Sbjct: 101 ATVRSKPVKPPYD-SISKSALY------SVSQVTNISYTKQLRKEPSFTSSELSLRISVR 153 Query: 158 QKSTSSGVLYRASSGNAMLLGHLGNLKQPGGKNSTT 51 K +G YRASS + M+ GHLGNL + + + T Sbjct: 154 GKPNPNGSTYRASSNHVMVPGHLGNLMKKKPEKTQT 189 >CDP01039.1 unnamed protein product [Coffea canephora] Length = 662 Score = 75.5 bits (184), Expect = 7e-13 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = -2 Query: 257 VSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLK 78 +S SQV N YTR LR+EPTFT SE S+ + +S G LYRAS+G+ ML+GHLGNLK Sbjct: 120 ISTSQVVNSEYTRMLRREPTFTSSEFSVTSHRKSNVSSKGHLYRASTGSVMLVGHLGNLK 179 Query: 77 QPGGKNSTTSN 45 Q G S + + Sbjct: 180 QKGHNKSLSDS 190 >XP_019152335.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Ipomoea nil] XP_019152336.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Ipomoea nil] Length = 569 Score = 74.7 bits (182), Expect = 1e-12 Identities = 42/87 (48%), Positives = 53/87 (60%), Gaps = 8/87 (9%) Frame = -2 Query: 248 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGV--------LYRASSGNAMLLGH 93 +QV N+AYT+RLR+EPTFT SELS+ I +KS+++ LYRASSGN ML GH Sbjct: 85 TQVANLAYTQRLRREPTFTSSELSVTIVGHRKSSAAATAAAGSGESLYRASSGNVMLPGH 144 Query: 92 LGNLKQPGGKNSTTSNIKTTMNYHATT 12 LGNL Q K N K ++ T Sbjct: 145 LGNLNQKPSKQKERPNGKVLGSHLGAT 171 >XP_009627310.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tomentosiformis] Length = 610 Score = 73.9 bits (180), Expect = 2e-12 Identities = 44/94 (46%), Positives = 62/94 (65%) Frame = -2 Query: 320 GTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSS 141 GTR S + S+ + R+S QV N+AYT++LR+EP+FT ++LSM I +KS ++ Sbjct: 117 GTR----NSNKASSNFSSVTRMS--QVVNLAYTQKLRREPSFTSTDLSMTIFSHRKSRTN 170 Query: 140 GVLYRASSGNAMLLGHLGNLKQPGGKNSTTSNIK 39 G L R S+GN LL HLGNLK G +N +S+IK Sbjct: 171 GTLNRDSTGNVSLLDHLGNLKLQGNQN-PSSDIK 203 >XP_015060167.1 PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein-like [Solanum pennellii] Length = 272 Score = 72.0 bits (175), Expect = 4e-12 Identities = 43/88 (48%), Positives = 57/88 (64%) Frame = -2 Query: 341 SSTNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAV 162 S TN ++ +R S K++ +RVS QV N+AYT++LR+EPTFT SELSM I Sbjct: 49 SDTNFVKNSRRCHTSSCPKNSTS-SKNRVS--QVVNLAYTQKLRREPTFTSSELSMTIFS 105 Query: 161 RQKSTSSGVLYRASSGNAMLLGHLGNLK 78 +KS +G L R+S+ N LL HLGNLK Sbjct: 106 HRKSKVNGTLNRSSTSNVTLLSHLGNLK 133 >OIT06002.1 inactive tpr repeat-containing thioredoxin ttl3 [Nicotiana attenuata] Length = 519 Score = 72.8 bits (177), Expect = 6e-12 Identities = 37/72 (51%), Positives = 52/72 (72%) Frame = -2 Query: 248 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 69 SQV N AYT++LR+EP+F+ ++LSM I +KS ++G L R+S+GN L HLGNLK G Sbjct: 119 SQVVNFAYTQKLRREPSFSSADLSMTIFSHRKSRTNGTLNRSSTGNVSKLSHLGNLKLQG 178 Query: 68 GKNSTTSNIKTT 33 +N +SNI T+ Sbjct: 179 NQN-PSSNINTS 189 >XP_019238407.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana attenuata] Length = 530 Score = 72.8 bits (177), Expect = 6e-12 Identities = 37/72 (51%), Positives = 52/72 (72%) Frame = -2 Query: 248 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 69 SQV N AYT++LR+EP+F+ ++LSM I +KS ++G L R+S+GN L HLGNLK G Sbjct: 130 SQVVNFAYTQKLRREPSFSSADLSMTIFSHRKSRTNGTLNRSSTGNVSKLSHLGNLKLQG 189 Query: 68 GKNSTTSNIKTT 33 +N +SNI T+ Sbjct: 190 NQN-PSSNINTS 200 >XP_016456821.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 611 Score = 72.8 bits (177), Expect = 6e-12 Identities = 43/94 (45%), Positives = 62/94 (65%) Frame = -2 Query: 320 GTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSS 141 GTR S + S+ + R++ QV N+AYT++LR+EP+FT ++LSM I +KS ++ Sbjct: 117 GTR----NSNKASSNFSSVTRMT--QVVNLAYTQKLRREPSFTSTDLSMTIFSHRKSRTN 170 Query: 140 GVLYRASSGNAMLLGHLGNLKQPGGKNSTTSNIK 39 G L R S+GN LL HLGNLK G +N +S+IK Sbjct: 171 GTLNRDSTGNVSLLDHLGNLKLQGNQN-PSSDIK 203 >XP_011074174.1 PREDICTED: TPR repeat-containing thioredoxin TTL4 [Sesamum indicum] Length = 560 Score = 67.8 bits (164), Expect = 3e-10 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = -2 Query: 254 SHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQ 75 S++ +N TRR +EPTFT SELS+ +A ++K ++ LYRAS+GN MLLGHLG+LKQ Sbjct: 95 SNNSGSNKRLTRRHTQEPTFTSSELSLALADQRKIDANSSLYRASTGNVMLLGHLGSLKQ 154 Query: 74 PG 69 G Sbjct: 155 HG 156 >XP_019241150.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana attenuata] OIT19695.1 inactive tpr repeat-containing thioredoxin ttl3 [Nicotiana attenuata] Length = 587 Score = 64.3 bits (155), Expect = 5e-09 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 1/83 (1%) Frame = -2 Query: 296 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 117 ST++S+ +++S QV N A +++LR+EPTFT S +S R KS ++G+L RASS Sbjct: 110 STKQSSNFSSTNKMS--QVVNFANSQKLRREPTFTSSVISHR-----KSNANGILNRASS 162 Query: 116 -GNAMLLGHLGNLKQPGGKNSTT 51 GN MLLG LGNLKQ +N ++ Sbjct: 163 TGNIMLLGQLGNLKQQKNQNGSS 185 >XP_016571551.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Capsicum annuum] Length = 566 Score = 61.6 bits (148), Expect = 4e-08 Identities = 42/84 (50%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -2 Query: 320 GTRPPLNGSTEKSAKILGLDRVSHSQVTN-VAYTRRLRKEPTFTESELSMRIAVRQKSTS 144 GTR + S K L SQV N V T+ LR++PTFT S+LS I QKS Sbjct: 74 GTRISSKNNNSSSTKKL-------SQVVNLVPNTQNLRRQPTFTSSDLSTTITGHQKSNV 126 Query: 143 SGVLYRASS-GNAMLLGHLGNLKQ 75 +G RASS GN MLLG LGNLKQ Sbjct: 127 NGTFNRASSTGNIMLLGQLGNLKQ 150 >XP_010261271.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 728 Score = 61.2 bits (147), Expect = 6e-08 Identities = 39/104 (37%), Positives = 49/104 (47%), Gaps = 5/104 (4%) Frame = -2 Query: 338 STNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYT-----RRLRKEPTFTESELSM 174 S +Q TR P +G T S + S + T R++ KE EL Sbjct: 99 SYHQQNQTRKPSDGITTSSTSSTDSSQTSSTTTTTTTKVSPTQGRKVPKEAIGISGELDS 158 Query: 173 RIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPGGKNSTTSNI 42 IA QKS + L RASSGN ML GHLGNL+Q G N + N+ Sbjct: 159 MIADHQKSKACNTLVRASSGNVMLYGHLGNLRQKGAGNMNSHNL 202 >XP_011022777.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Populus euphratica] Length = 606 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/67 (49%), Positives = 41/67 (61%) Frame = -2 Query: 248 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 69 +Q +V + RR+ KE EL I+ QKS S L RASS N MLLG+LGNL+Q G Sbjct: 121 NQNAHVKHGRRVPKEAVGLSGELESYISDHQKSKGSSTLVRASSSNVMLLGNLGNLRQGG 180 Query: 68 GKNSTTS 48 G +TTS Sbjct: 181 GGGNTTS 187 >XP_010269225.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 721 Score = 59.3 bits (142), Expect = 3e-07 Identities = 38/93 (40%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = -2 Query: 317 TRPPLN-GSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSS 141 T P N S + SA + +VS +Q V R++ KE EL I QK+ S Sbjct: 107 TNAPSNMASIQTSATTATITKVSPTQ--GVGQGRKVPKEAISISGELDSMITDHQKTKGS 164 Query: 140 GVLYRASSGNAMLLGHLGNLKQPGGKNSTTSNI 42 L RASS N ML GHLGNL+Q G NS ++N+ Sbjct: 165 SGLVRASSSNVMLFGHLGNLRQSGSGNSNSNNL 197 >XP_016476276.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 587 Score = 58.9 bits (141), Expect = 4e-07 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = -2 Query: 296 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 117 ST++S+ +++S QV N A +++LR EPTFT S +S R KS ++G+L SS Sbjct: 110 STKQSSNFSSTNKMS--QVVNFANSQKLRMEPTFTSSVISHR-----KSNANGILNGVSS 162 Query: 116 -GNAMLLGHLGNLKQPGGKNSTT 51 GN MLLG LGNLKQ +N ++ Sbjct: 163 TGNIMLLGQLGNLKQQKNQNGSS 185 >XP_009759360.1 PREDICTED: TPR repeat-containing thioredoxin TTL4 [Nicotiana sylvestris] XP_016500635.1 PREDICTED: TPR repeat-containing thioredoxin TTL4-like [Nicotiana tabacum] Length = 602 Score = 58.5 bits (140), Expect = 5e-07 Identities = 39/112 (34%), Positives = 52/112 (46%), Gaps = 7/112 (6%) Frame = -2 Query: 338 STNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTN----VAYTRRLRKEP---TFTESEL 180 S Q P N + K+A ++ H+Q N Y + RK P T EL Sbjct: 74 SEKQADRIIPRPNPNQSKAAVAASQNKAIHNQQKNGQVVQGYNNQGRKVPQAATGISGEL 133 Query: 179 SMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPGGKNSTTSNIKTTMNY 24 I Q+S + L RASS N ML G+LGN++Q GG N T S +T N+ Sbjct: 134 ETMIQDHQRSKGANTLVRASSSNVMLFGNLGNIRQQGGSNGTASTTTSTANH 185 >XP_002309983.2 hypothetical protein POPTR_0007s05640g, partial [Populus trichocarpa] EEE90433.2 hypothetical protein POPTR_0007s05640g, partial [Populus trichocarpa] Length = 573 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/67 (49%), Positives = 40/67 (59%) Frame = -2 Query: 248 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 69 +Q V + RR+ KE EL I+ QKS S L RASS N MLLG+LGNL+Q G Sbjct: 121 NQNAYVKHGRRVPKEAVGLSGELESYISDHQKSKGSSTLVRASSSNVMLLGNLGNLRQGG 180 Query: 68 GKNSTTS 48 G +TTS Sbjct: 181 GGGNTTS 187