BLASTX nr result
ID: Panax25_contig00017978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017978 (547 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM88660.1 zeaxanthin epoxidase [Daucus carota subsp. sativus] 58 1e-06 NP_001316090.1 zeaxanthin epoxidase, chloroplastic [Daucus carot... 57 2e-06 >KZM88660.1 zeaxanthin epoxidase [Daucus carota subsp. sativus] Length = 668 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = -3 Query: 545 HPSDVIELGSDKKVGFRVKVMKFP---AENKEGSEALQAV 435 HPSD+I GSD+KV FRVKVMKFP AEN EGS ALQAV Sbjct: 629 HPSDIIGFGSDEKVAFRVKVMKFPSQVAENTEGSAALQAV 668 >NP_001316090.1 zeaxanthin epoxidase, chloroplastic [Daucus carota subsp. sativus] ABB52077.1 putative zeaxanthin epoxidase [Daucus carota subsp. sativus] Length = 668 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = -3 Query: 545 HPSDVIELGSDKKVGFRVKVMKFP---AENKEGSEALQAV 435 HPSD+I GSD+KV FRVKVMKFP AEN EGS ALQAV Sbjct: 629 HPSDIIGFGSDEKVAFRVKVMKFPSQVAENTEGSGALQAV 668