BLASTX nr result
ID: Panax25_contig00017934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017934 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008370008.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 67 3e-11 ADN34235.1 hypothetical protein [Cucumis melo subsp. melo] 64 3e-11 XP_008370006.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 67 3e-11 XP_017223751.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 69 3e-11 XP_013449418.1 COP9 signalosome complex subunit-like protein [Me... 69 3e-11 AFK41427.1 unknown [Medicago truncatula] 69 3e-11 KHN27385.1 COP9 signalosome complex subunit 7 [Glycine soja] 68 8e-11 OAY62513.1 hypothetical protein MANES_01G272900 [Manihot esculenta] 68 8e-11 KYP38967.1 COP9 signalosome complex subunit 7 [Cajanus cajan] 68 8e-11 XP_017433906.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 68 8e-11 XP_014514823.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 68 8e-11 XP_011017341.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 68 8e-11 XP_006386542.1 hypothetical protein POPTR_0002s13830g [Populus t... 68 8e-11 XP_004492937.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 68 8e-11 XP_003546686.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 68 8e-11 XP_003542787.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 68 8e-11 XP_002273686.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 68 8e-11 GAV82458.1 PCI domain-containing protein [Cephalotus follicularis] 68 8e-11 XP_008369168.1 PREDICTED: COP9 signalosome complex subunit 7-lik... 65 9e-11 XP_016544968.1 PREDICTED: COP9 signalosome complex subunit 7 iso... 67 1e-10 >XP_008370008.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X2 [Malus domestica] XP_008370009.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X2 [Malus domestica] Length = 162 Score = 67.4 bits (163), Expect = 3e-11 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPL 337 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP+ Sbjct: 125 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 159 >ADN34235.1 hypothetical protein [Cucumis melo subsp. melo] Length = 51 Score = 64.3 bits (155), Expect = 3e-11 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 AN D R HEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 16 ANIDIREHEEIYSEPGGVMDYEEDRSRPKRRRHPIS 51 >XP_008370006.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X1 [Malus domestica] Length = 169 Score = 67.4 bits (163), Expect = 3e-11 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPL 337 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP+ Sbjct: 132 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 166 >XP_017223751.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X2 [Daucus carota subsp. sativus] Length = 259 Score = 68.9 bits (167), Expect = 3e-11 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A +FRGHEE F+ESGGVMDYDEDR+RPKRRRHP+A Sbjct: 224 AELEFRGHEEFFSESGGVMDYDEDRTRPKRRRHPMA 259 >XP_013449418.1 COP9 signalosome complex subunit-like protein [Medicago truncatula] KEH23446.1 COP9 signalosome complex subunit-like protein [Medicago truncatula] Length = 259 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI AESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICAESGGVMDYEEDRSRPKRRRHPIS 259 >AFK41427.1 unknown [Medicago truncatula] Length = 259 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI AESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICAESGGVMDYEEDRSRPKRRRHPIS 259 >KHN27385.1 COP9 signalosome complex subunit 7 [Glycine soja] Length = 258 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 223 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 258 >OAY62513.1 hypothetical protein MANES_01G272900 [Manihot esculenta] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPIS 259 >KYP38967.1 COP9 signalosome complex subunit 7 [Cajanus cajan] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_017433906.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X1 [Vigna angularis] BAT89848.1 hypothetical protein VIGAN_06094900 [Vigna angularis var. angularis] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_014514823.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X1 [Vigna radiata var. radiata] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_011017341.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X1 [Populus euphratica] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPMS 259 >XP_006386542.1 hypothetical protein POPTR_0002s13830g [Populus trichocarpa] ERP64339.1 hypothetical protein POPTR_0002s13830g [Populus trichocarpa] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPMS 259 >XP_004492937.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X1 [Cicer arietinum] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_003546686.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X1 [Glycine max] KRH13242.1 hypothetical protein GLYMA_15G224900 [Glycine max] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_003542787.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X1 [Glycine max] KHN10326.1 COP9 signalosome complex subunit 7 [Glycine soja] KRH20583.1 hypothetical protein GLYMA_13G187200 [Glycine max] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI +ESGGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPIS 259 >XP_002273686.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X1 [Vitis vinifera] CBI16662.3 unnamed protein product, partial [Vitis vinifera] Length = 259 Score = 67.8 bits (164), Expect = 8e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPIS 259 >GAV82458.1 PCI domain-containing protein [Cephalotus follicularis] Length = 260 Score = 67.8 bits (164), Expect = 8e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPLA 334 A+ DFRGHEEI++E GGVMDY+EDRSRPKRRRHP++ Sbjct: 225 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPIS 260 >XP_008369168.1 PREDICTED: COP9 signalosome complex subunit 7-like isoform X1 [Malus domestica] Length = 126 Score = 65.1 bits (157), Expect = 9e-11 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPL 337 A+ DF GHEEI++E GGVMDY+EDRSRPKRRRHP+ Sbjct: 89 ADIDFXGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 123 >XP_016544968.1 PREDICTED: COP9 signalosome complex subunit 7 isoform X1 [Capsicum annuum] Length = 259 Score = 67.4 bits (163), Expect = 1e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 441 ANFDFRGHEEIFAESGGVMDYDEDRSRPKRRRHPL 337 A+ DFRGHEEI++ESGGVMDY+EDR RPKRRRHP+ Sbjct: 224 ADVDFRGHEEIYSESGGVMDYEEDRGRPKRRRHPI 258