BLASTX nr result
ID: Panax25_contig00017931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017931 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI06834.1 hypothetical protein Ccrd_014811 [Cynara cardunculus ... 59 7e-07 >KVI06834.1 hypothetical protein Ccrd_014811 [Cynara cardunculus var. scolymus] Length = 1045 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRPFDIGACLQARQPVSLIAEASATSSAIK 90 LRPFDIGACLQARQP SLIAEASATSSAIK Sbjct: 1016 LRPFDIGACLQARQPASLIAEASATSSAIK 1045