BLASTX nr result
ID: Panax25_contig00017890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017890 (684 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019245320.1 PREDICTED: cell number regulator 6-like isoform X... 78 7e-14 XP_016462491.1 PREDICTED: cell number regulator 6-like [Nicotian... 78 7e-14 XP_009801117.1 PREDICTED: cell number regulator 6-like [Nicotian... 78 7e-14 XP_009602303.1 PREDICTED: cell number regulator 6-like [Nicotian... 78 7e-14 CDP07787.1 unnamed protein product [Coffea canephora] 75 6e-13 XP_015877797.1 PREDICTED: cell number regulator 6-like isoform X... 75 6e-13 XP_015067513.1 PREDICTED: cell number regulator 6 [Solanum penne... 75 6e-13 XP_008439084.1 PREDICTED: cell number regulator 6 [Cucumis melo]... 75 6e-13 XP_006358252.1 PREDICTED: cell number regulator 6 [Solanum tuber... 75 6e-13 XP_004148145.1 PREDICTED: cell number regulator 6 [Cucumis sativ... 75 6e-13 XP_019192561.1 PREDICTED: cell number regulator 6-like [Ipomoea ... 75 7e-13 XP_015877796.1 PREDICTED: cell number regulator 6-like isoform X... 75 7e-13 CDP05338.1 unnamed protein product [Coffea canephora] 75 9e-13 XP_016564851.1 PREDICTED: uncharacterized protein LOC107863447 i... 74 2e-12 XP_010536540.1 PREDICTED: cell number regulator 6 [Tarenaya hass... 74 2e-12 XP_002510957.1 PREDICTED: cell number regulator 6 [Ricinus commu... 74 2e-12 XP_010555614.1 PREDICTED: cell number regulator 6-like [Tarenaya... 74 2e-12 ONK59142.1 uncharacterized protein A4U43_C08F3420 [Asparagus off... 74 2e-12 XP_008802784.1 PREDICTED: cell number regulator 6-like [Phoenix ... 71 2e-12 XP_011018322.1 PREDICTED: cell number regulator 6-like isoform X... 73 2e-12 >XP_019245320.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245327.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245331.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245337.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] OIT07892.1 cell number regulator 6 [Nicotiana attenuata] Length = 239 Score = 78.2 bits (191), Expect = 7e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLAVRKCHECGQPLPESFEPPADEPWTTGIFG 67 >XP_016462491.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016462492.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] Length = 239 Score = 78.2 bits (191), Expect = 7e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLAVRKCHECGQPLPESFEPPADEPWTTGIFG 67 >XP_009801117.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801118.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801119.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801120.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_016437849.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016437850.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016437851.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] Length = 239 Score = 78.2 bits (191), Expect = 7e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLAVRKCHECGQPLPESFEPPADEPWTTGIFG 67 >XP_009602303.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602304.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602305.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602306.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] Length = 239 Score = 78.2 bits (191), Expect = 7e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLAVRKCHECGQPLPESFEPPADEPWTTGIFG 67 >CDP07787.1 unnamed protein product [Coffea canephora] Length = 238 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLEVRKCNECGQPLPESFEPPADEPWTTGIFG 67 >XP_015877797.1 PREDICTED: cell number regulator 6-like isoform X2 [Ziziphus jujuba] Length = 239 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPESFEPPADEPWTTGIFG 67 >XP_015067513.1 PREDICTED: cell number regulator 6 [Solanum pennellii] Length = 239 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL RKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLSGRKCHECGQPLPESFEPPADEPWTTGIFG 67 >XP_008439084.1 PREDICTED: cell number regulator 6 [Cucumis melo] XP_008439085.1 PREDICTED: cell number regulator 6 [Cucumis melo] Length = 239 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPESFEPPADEPWTTGIFG 67 >XP_006358252.1 PREDICTED: cell number regulator 6 [Solanum tuberosum] XP_015169354.1 PREDICTED: cell number regulator 6 [Solanum tuberosum] Length = 239 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL RKCHECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLAGRKCHECGQPLPESFEPPADEPWTTGIFG 67 >XP_004148145.1 PREDICTED: cell number regulator 6 [Cucumis sativus] KGN57264.1 hypothetical protein Csa_3G175650 [Cucumis sativus] Length = 239 Score = 75.5 bits (184), Expect = 6e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPESFEPPADEPWTTGIFG 67 >XP_019192561.1 PREDICTED: cell number regulator 6-like [Ipomoea nil] XP_019192562.1 PREDICTED: cell number regulator 6-like [Ipomoea nil] Length = 241 Score = 75.5 bits (184), Expect = 7e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 35 VPQLAVRKCNECGQPLPESFEPPADEPWTTGIFG 68 >XP_015877796.1 PREDICTED: cell number regulator 6-like isoform X1 [Ziziphus jujuba] Length = 247 Score = 75.5 bits (184), Expect = 7e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPESFEPPADEPWTTGIFG 67 >CDP05338.1 unnamed protein product [Coffea canephora] Length = 241 Score = 75.1 bits (183), Expect = 9e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPESFEPPADEPWTTGIFG Sbjct: 36 VPQLGVRKCNECGQPLPESFEPPADEPWTTGIFG 69 >XP_016564851.1 PREDICTED: uncharacterized protein LOC107863447 isoform X2 [Capsicum annuum] Length = 215 Score = 73.9 bits (180), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKCHECGQ LPESF+PPADEPWTTGIFG Sbjct: 34 VPQLTVRKCHECGQALPESFQPPADEPWTTGIFG 67 >XP_010536540.1 PREDICTED: cell number regulator 6 [Tarenaya hassleriana] XP_010536541.1 PREDICTED: cell number regulator 6 [Tarenaya hassleriana] Length = 236 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPE+FEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPENFEPPADEPWTTGIFG 67 >XP_002510957.1 PREDICTED: cell number regulator 6 [Ricinus communis] EEF51559.1 conserved hypothetical protein [Ricinus communis] Length = 236 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPE+FEPPADEPWTTGIFG Sbjct: 35 VPQLNVRKCNECGQPLPENFEPPADEPWTTGIFG 68 >XP_010555614.1 PREDICTED: cell number regulator 6-like [Tarenaya hassleriana] Length = 237 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPE+FEPPADEPWTTGIFG Sbjct: 34 VPQLNVRKCNECGQPLPENFEPPADEPWTTGIFG 67 >ONK59142.1 uncharacterized protein A4U43_C08F3420 [Asparagus officinalis] Length = 238 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPES+EPPADEPWTTGIFG Sbjct: 34 VPQLEVRKCNECGQPLPESYEPPADEPWTTGIFG 67 >XP_008802784.1 PREDICTED: cell number regulator 6-like [Phoenix dactylifera] Length = 96 Score = 70.9 bits (172), Expect = 2e-12 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VR+C+ECGQPLPES+EPPADEPW TGIFG Sbjct: 35 VPQLEVRRCNECGQPLPESYEPPADEPWMTGIFG 68 >XP_011018322.1 PREDICTED: cell number regulator 6-like isoform X2 [Populus euphratica] XP_011018323.1 PREDICTED: cell number regulator 6-like isoform X2 [Populus euphratica] Length = 169 Score = 72.8 bits (177), Expect = 2e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 104 VPQLYVRKCHECGQPLPESFEPPADEPWTTGIFG 3 VPQL VRKC+ECGQPLPE+FEPP DEPWTTGIFG Sbjct: 33 VPQLTVRKCNECGQPLPENFEPPGDEPWTTGIFG 66