BLASTX nr result
ID: Panax25_contig00017676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017676 (599 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016451660.1 PREDICTED: serine/threonine-protein kinase tricor... 58 1e-06 CDP08298.1 unnamed protein product [Coffea canephora] 58 1e-06 XP_019230637.1 PREDICTED: serine/threonine-protein kinase tricor... 58 1e-06 XP_009781312.1 PREDICTED: serine/threonine-protein kinase tricor... 58 1e-06 XP_016489243.1 PREDICTED: serine/threonine-protein kinase tricor... 58 1e-06 EPS57773.1 hypothetical protein M569_17044, partial [Genlisea au... 56 2e-06 XP_015085489.1 PREDICTED: serine/threonine-protein kinase tricor... 57 3e-06 XP_006351599.1 PREDICTED: serine/threonine-protein kinase 38-lik... 57 3e-06 XP_004245072.1 PREDICTED: serine/threonine-protein kinase tricor... 57 3e-06 XP_010325022.1 PREDICTED: serine/threonine-protein kinase tricor... 57 4e-06 EYU29338.1 hypothetical protein MIMGU_mgv1a005030mg [Erythranthe... 57 5e-06 XP_019161921.1 PREDICTED: serine/threonine-protein kinase tricor... 57 5e-06 XP_019161920.1 PREDICTED: serine/threonine-protein kinase tricor... 57 5e-06 XP_016537786.1 PREDICTED: serine/threonine-protein kinase 38 iso... 56 9e-06 XP_011100578.1 PREDICTED: serine/threonine-protein kinase tricor... 56 9e-06 >XP_016451660.1 PREDICTED: serine/threonine-protein kinase tricorner-like isoform X2 [Nicotiana tabacum] Length = 458 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNS 5 R MLLTPKDLSFVGYTYKNFDAVKALRNS Sbjct: 382 RKMLLTPKDLSFVGYTYKNFDAVKALRNS 410 >CDP08298.1 unnamed protein product [Coffea canephora] Length = 504 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R MLLTPKDLSFVGYTYKNFDAVK LRNSS Sbjct: 428 RKMLLTPKDLSFVGYTYKNFDAVKTLRNSS 457 >XP_019230637.1 PREDICTED: serine/threonine-protein kinase tricorner-like [Nicotiana attenuata] OIT29289.1 putative serinethreonine protein kinase ire4 [Nicotiana attenuata] Length = 522 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNS 5 R MLLTPKDLSFVGYTYKNFDAVKALRNS Sbjct: 446 RKMLLTPKDLSFVGYTYKNFDAVKALRNS 474 >XP_009781312.1 PREDICTED: serine/threonine-protein kinase tricorner-like [Nicotiana sylvestris] XP_009781313.1 PREDICTED: serine/threonine-protein kinase tricorner-like [Nicotiana sylvestris] XP_016451659.1 PREDICTED: serine/threonine-protein kinase tricorner-like isoform X1 [Nicotiana tabacum] Length = 522 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNS 5 R MLLTPKDLSFVGYTYKNFDAVKALRNS Sbjct: 446 RKMLLTPKDLSFVGYTYKNFDAVKALRNS 474 >XP_016489243.1 PREDICTED: serine/threonine-protein kinase tricorner-like [Nicotiana tabacum] XP_018632393.1 PREDICTED: serine/threonine-protein kinase tricorner [Nicotiana tomentosiformis] Length = 522 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNS 5 R MLLTPKDLSFVGYTYKNFDAVKALRNS Sbjct: 446 RKMLLTPKDLSFVGYTYKNFDAVKALRNS 474 >EPS57773.1 hypothetical protein M569_17044, partial [Genlisea aurea] Length = 152 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R MLLTPKDL+FVGYTYKNFDA+KALRN S Sbjct: 100 RKMLLTPKDLNFVGYTYKNFDAIKALRNLS 129 >XP_015085489.1 PREDICTED: serine/threonine-protein kinase tricorner [Solanum pennellii] Length = 520 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R M LTPKDLSFVGYTYKNFDAVKALRNSS Sbjct: 444 RKMSLTPKDLSFVGYTYKNFDAVKALRNSS 473 >XP_006351599.1 PREDICTED: serine/threonine-protein kinase 38-like [Solanum tuberosum] Length = 520 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R M LTPKDLSFVGYTYKNFDAVKALRNSS Sbjct: 444 RKMSLTPKDLSFVGYTYKNFDAVKALRNSS 473 >XP_004245072.1 PREDICTED: serine/threonine-protein kinase tricorner isoform X1 [Solanum lycopersicum] Length = 520 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R M LTPKDLSFVGYTYKNFDAVKALRNSS Sbjct: 444 RKMSLTPKDLSFVGYTYKNFDAVKALRNSS 473 >XP_010325022.1 PREDICTED: serine/threonine-protein kinase tricorner isoform X2 [Solanum lycopersicum] Length = 504 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 85 MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 M LTPKDLSFVGYTYKNFDAVKALRNSS Sbjct: 430 MSLTPKDLSFVGYTYKNFDAVKALRNSS 457 >EYU29338.1 hypothetical protein MIMGU_mgv1a005030mg [Erythranthe guttata] Length = 500 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R +LLTPKDLSFVGYTYKNFDA+KALRN S Sbjct: 440 RKLLLTPKDLSFVGYTYKNFDAIKALRNKS 469 >XP_019161921.1 PREDICTED: serine/threonine-protein kinase tricorner isoform X2 [Ipomoea nil] Length = 503 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R MLLT KDLSFVGYTYKNFDAVKALRNSS Sbjct: 442 RKMLLTSKDLSFVGYTYKNFDAVKALRNSS 471 >XP_019161920.1 PREDICTED: serine/threonine-protein kinase tricorner isoform X1 [Ipomoea nil] Length = 520 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R MLLT KDLSFVGYTYKNFDAVKALRNSS Sbjct: 442 RKMLLTSKDLSFVGYTYKNFDAVKALRNSS 471 >XP_016537786.1 PREDICTED: serine/threonine-protein kinase 38 isoform X1 [Capsicum annuum] Length = 519 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNS 5 R M LTPKDLSFVGYTYKNFDAVKALRNS Sbjct: 447 RKMSLTPKDLSFVGYTYKNFDAVKALRNS 475 >XP_011100578.1 PREDICTED: serine/threonine-protein kinase tricorner-like [Sesamum indicum] Length = 523 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 91 R*MLLTPKDLSFVGYTYKNFDAVKALRNSS 2 R M LTPKDL+FVGYTYKNFDAVKALRNSS Sbjct: 447 RKMHLTPKDLNFVGYTYKNFDAVKALRNSS 476