BLASTX nr result
ID: Panax25_contig00017638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017638 (1487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus cl... 73 1e-12 XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago trunc... 57 2e-09 XP_003601656.2 rhodanese/cell cycle control phosphatase superfam... 58 2e-09 XP_013461206.1 rhodanese/cell cycle control phosphatase superfam... 58 2e-09 KVI08263.1 hypothetical protein Ccrd_013365 [Cynara cardunculus ... 60 1e-07 ACU23295.1 unknown [Glycine max] 56 1e-06 >XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] ESR34253.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/61 (57%), Positives = 40/61 (65%) Frame = +1 Query: 220 YPGGGNGKQRDIAQNPATSNPSTVEKQNCFYYFQAAVFQ*DKEPATILLSMHHVLVFISR 399 YPGGGNGKQRDIAQN + +K+ YF A+FQ EP T+LLSMHHV FIS Sbjct: 7 YPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTFISS 66 Query: 400 F 402 F Sbjct: 67 F 67 >XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago truncatula] AET04083.2 hypothetical protein MTR_8g081570 [Medicago truncatula] Length = 583 Score = 56.6 bits (135), Expect(2) = 2e-09 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -1 Query: 296 FSTVLGLLVAGFCAMSRCFPFPPPGYEKKPSLDDNDIL 183 F L ++GFCAMSRCFPFPPPGYEKK D+ D+L Sbjct: 11 FVPFLEQCISGFCAMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 35.4 bits (80), Expect(2) = 2e-09 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 378 MVHGQENSCWFLILLEHC 325 MVHGQE+SCWF+ LE C Sbjct: 1 MVHGQEHSCWFVPFLEQC 18 >XP_003601656.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] AES71907.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1378 Score = 57.8 bits (138), Expect(2) = 2e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 272 VAGFCAMSRCFPFPPPGYEKKPSLDDNDIL 183 ++GFCAMSRCFPFPPPGYEKK DD D+L Sbjct: 23 ISGFCAMSRCFPFPPPGYEKKSRTDDVDLL 52 Score = 33.9 bits (76), Expect(2) = 2e-09 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 378 MVHGQENSCWFLILLE 331 MVHGQENSCWF + LE Sbjct: 1 MVHGQENSCWFDLFLE 16 >XP_013461206.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] KEH35240.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1330 Score = 57.8 bits (138), Expect(2) = 2e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 272 VAGFCAMSRCFPFPPPGYEKKPSLDDNDIL 183 ++GFCAMSRCFPFPPPGYEKK DD D+L Sbjct: 23 ISGFCAMSRCFPFPPPGYEKKSRTDDVDLL 52 Score = 33.9 bits (76), Expect(2) = 2e-09 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 378 MVHGQENSCWFLILLE 331 MVHGQENSCWF + LE Sbjct: 1 MVHGQENSCWFDLFLE 16 >KVI08263.1 hypothetical protein Ccrd_013365 [Cynara cardunculus var. scolymus] Length = 705 Score = 60.1 bits (144), Expect(2) = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 275 LVAGFCAMSRCFPFPPPGYEKKPSLDDNDIL 183 LV G CAMSRCFPFPPPGYEKKP+ DD D+L Sbjct: 86 LVRGACAMSRCFPFPPPGYEKKPTTDDADLL 116 Score = 25.8 bits (55), Expect(2) = 1e-07 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 411 KSGEPGNEHKDMVHGQEN 358 K E GNE +DMV+G+EN Sbjct: 66 KGIESGNECEDMVNGEEN 83 >ACU23295.1 unknown [Glycine max] Length = 60 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = -3 Query: 378 MVHGQENSCWFLILLEHCCLKVIEAILFLHGAWIACCGILCNVSLLSISSTRI*KE 211 MVHGQE+SCWF+ LE K+I+A L + ILCNV+L SIS+TRI KE Sbjct: 1 MVHGQEHSCWFVPFLEQGYWKIIQAPSNLEEFYTRRIWILCNVALFSISTTRIWKE 56