BLASTX nr result
ID: Panax25_contig00017611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017611 (1013 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACN96317.1 class 1 chitinase [Panax ginseng] 63 2e-07 >ACN96317.1 class 1 chitinase [Panax ginseng] Length = 323 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 511 WTVTIFILASSLAVSAEQCGKQAGMALCPKKL 606 WTVTIFILASSLAVSAEQCGKQAGMALCP L Sbjct: 4 WTVTIFILASSLAVSAEQCGKQAGMALCPNGL 35