BLASTX nr result
ID: Panax25_contig00017579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017579 (924 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018848306.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 2e-14 XP_008442434.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-13 XP_016545481.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-12 XP_019057943.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 KVH89533.1 Pentatricopeptide repeat-containing protein [Cynara c... 77 4e-12 CDO99549.1 unnamed protein product [Coffea canephora] 77 4e-12 XP_017975863.1 PREDICTED: glucuronokinase 1 [Theobroma cacao] 74 3e-11 XP_011653157.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-11 XP_019251934.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-11 EOY02539.1 Glucuronokinase G [Theobroma cacao] 74 3e-11 XP_010273709.1 PREDICTED: glucuronokinase 1-like [Nelumbo nucifera] 74 4e-11 XP_006361033.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-11 XP_016512973.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-11 XP_009618814.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-11 ERM95186.1 hypothetical protein AMTR_s00009p00264540 [Amborella ... 73 8e-11 XP_015899696.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 8e-11 EPS69261.1 hypothetical protein M569_05505, partial [Genlisea au... 72 9e-11 XP_011626188.1 PREDICTED: putative pentatricopeptide repeat-cont... 73 1e-10 KHG01453.1 Glucuronokinase 1 -like protein [Gossypium arboreum] 72 1e-10 XP_010550164.1 PREDICTED: glucuronokinase 1-like isoform X2 [Tar... 72 1e-10 >XP_018848306.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Juglans regia] Length = 485 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/51 (68%), Positives = 47/51 (92%) Frame = -2 Query: 911 SLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 SLY+RIS +GDP++SVVP+LDQW+++GR + K+ELQ II+ELK+YKRFKHA Sbjct: 32 SLYRRISPVGDPNVSVVPILDQWIQEGRHVDKEELQSIIKELKDYKRFKHA 82 >XP_008442434.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis melo] Length = 455 Score = 80.5 bits (197), Expect = 3e-13 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 ++LY+RIS +GDP+ISV+PVLDQWV +GR ++K+ELQ II+EL+ YKRFKHA Sbjct: 29 DNLYRRISPVGDPNISVIPVLDQWVLEGRVVQKEELQKIIKELRVYKRFKHA 80 >XP_016545481.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Capsicum annuum] Length = 492 Score = 78.6 bits (192), Expect = 1e-12 Identities = 31/52 (59%), Positives = 47/52 (90%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +SLY+RIS IGDP +S+VPVLDQW+++G+ + K+ELQ II+EL++++R+KHA Sbjct: 41 DSLYRRISPIGDPKVSIVPVLDQWIKEGKHVVKEELQSIIKELRSFRRYKHA 92 >XP_019057943.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Tarenaya hassleriana] Length = 98 Score = 71.6 bits (174), Expect = 3e-12 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 908 LYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 LYKRIS +GDP S+VPVLD+WVR+G + KQ+L+ +I+EL Y RF HA Sbjct: 40 LYKRISPLGDPKFSIVPVLDEWVREGNSVNKQQLRQLIKELTKYSRFGHA 89 >KVH89533.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 505 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 911 SLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 SLY+RIS +GDP IS++PVLDQWV +GRE+ K+ L +II LK YKRFKHA Sbjct: 72 SLYRRISPVGDPDISIIPVLDQWVSEGREVDKESLINIIASLKKYKRFKHA 122 >CDO99549.1 unnamed protein product [Coffea canephora] Length = 506 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 911 SLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +LYKRIS +GDP ISVVPVLDQW +GR + KQ L+ I++ELK YKR+KHA Sbjct: 41 NLYKRISPLGDPKISVVPVLDQWAAEGRPVHKQYLESIVKELKAYKRYKHA 91 >XP_017975863.1 PREDICTED: glucuronokinase 1 [Theobroma cacao] Length = 361 Score = 73.9 bits (180), Expect = 3e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFYKVRHLIKVEVRPNLILNAEKE+GIV Sbjct: 129 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 169 >XP_011653157.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] KGN64672.1 hypothetical protein Csa_1G073790 [Cucumis sativus] Length = 461 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/55 (58%), Positives = 47/55 (85%) Frame = -2 Query: 923 LLPESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 ++ ++LY+RIS +GDP+ISV P+LDQWV +GR +++ EL+ II+EL+ YKRFKHA Sbjct: 26 VVKDNLYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHA 80 >XP_019251934.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Nicotiana attenuata] OIS99235.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 475 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/52 (55%), Positives = 46/52 (88%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +SLY+RIS +GDP+ S+VPVLDQW+ +G+ + K++LQ++I+EL+ Y+R+KHA Sbjct: 40 DSLYRRISPLGDPNESIVPVLDQWINEGKHVVKEDLQNMIKELRGYRRYKHA 91 >EOY02539.1 Glucuronokinase G [Theobroma cacao] Length = 383 Score = 73.9 bits (180), Expect = 3e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFYKVRHLIKVEVRPNLILNAEKE+GIV Sbjct: 151 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 191 >XP_010273709.1 PREDICTED: glucuronokinase 1-like [Nelumbo nucifera] Length = 366 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFYKVRHL+KVEVRPNLILNAEKE+GIV Sbjct: 135 SSAIVCAALSCLLDFYKVRHLVKVEVRPNLILNAEKELGIV 175 >XP_006361033.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum tuberosum] Length = 472 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/52 (57%), Positives = 46/52 (88%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +SLY+RIS +GDP+ S+VPVLDQW+++G+ + K+ELQ +I+ LK+Y+R+KHA Sbjct: 40 DSLYRRISPLGDPNESIVPVLDQWIKEGKHVVKKELQYMIKSLKDYRRYKHA 91 >XP_016512973.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Nicotiana tabacum] Length = 476 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/52 (55%), Positives = 47/52 (90%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +SLY+RIS +GDP+ S+VPVLDQW+++G+ + K++LQ++I+EL+ Y+R+KHA Sbjct: 41 DSLYRRISPLGDPNESIVPVLDQWIKEGKFVVKEDLQNMIKELRGYRRYKHA 92 >XP_009618814.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Nicotiana tomentosiformis] Length = 476 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/52 (55%), Positives = 47/52 (90%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +SLY+RIS +GDP+ S+VPVLDQW+++G+ + K++LQ++I+EL+ Y+R+KHA Sbjct: 41 DSLYRRISPLGDPNESIVPVLDQWIKEGKFVVKEDLQNMIKELRGYRRYKHA 92 >ERM95186.1 hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda] Length = 503 Score = 73.2 bits (178), Expect = 8e-11 Identities = 27/52 (51%), Positives = 45/52 (86%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +S++KRIS +GDP SVVP+L++WVR+GR++ K +LQ +++E++ Y+R+KHA Sbjct: 34 DSIFKRISPLGDPGTSVVPLLEEWVREGRKVHKSDLQSLVKEMRRYRRYKHA 85 >XP_015899696.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Ziziphus jujuba] Length = 523 Score = 73.2 bits (178), Expect = 8e-11 Identities = 29/52 (55%), Positives = 44/52 (84%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 ++LY++IS IGDP +S+VPVLD+W+ GR + K+ L DII+EL++Y+R+KHA Sbjct: 50 DALYRKISPIGDPKVSIVPVLDKWIHDGRAVDKRRLLDIIKELRHYRRYKHA 101 >EPS69261.1 hypothetical protein M569_05505, partial [Genlisea aurea] Length = 343 Score = 72.4 bits (176), Expect = 9e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFY+VRHLIKVEVRPNLILNAEKE+GIV Sbjct: 119 SSAIVCAALSCLLDFYEVRHLIKVEVRPNLILNAEKELGIV 159 >XP_011626188.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Amborella trichopoda] Length = 945 Score = 73.2 bits (178), Expect = 1e-10 Identities = 27/52 (51%), Positives = 45/52 (86%) Frame = -2 Query: 914 ESLYKRISSIGDPSISVVPVLDQWVRKGREIRKQELQDIIRELKNYKRFKHA 759 +S++KRIS +GDP SVVP+L++WVR+GR++ K +LQ +++E++ Y+R+KHA Sbjct: 34 DSIFKRISPLGDPGTSVVPLLEEWVREGRKVHKSDLQSLVKEMRRYRRYKHA 85 >KHG01453.1 Glucuronokinase 1 -like protein [Gossypium arboreum] Length = 329 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFYKVRHLIKVEVRPNLIL+AEKE+GIV Sbjct: 136 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILSAEKELGIV 176 >XP_010550164.1 PREDICTED: glucuronokinase 1-like isoform X2 [Tarenaya hassleriana] Length = 295 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 613 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKEIGIV 491 +S VC ALSCLLDFY VRHLIKVEVRPNL+LNAEKE+GIV Sbjct: 66 SSAIVCAALSCLLDFYNVRHLIKVEVRPNLVLNAEKELGIV 106