BLASTX nr result
ID: Panax25_contig00017464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017464 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH95186.1 hypothetical protein Ccrd_002741 [Cynara cardunculus ... 77 5e-16 KZM80577.1 hypothetical protein DCAR_032084 [Daucus carota subsp... 83 6e-16 XP_017228633.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Dau... 83 6e-16 KZM90934.1 hypothetical protein DCAR_021701 [Daucus carota subsp... 82 1e-15 CDY53289.1 BnaA05g35990D [Brassica napus] 75 1e-15 XP_016454522.1 PREDICTED: E3 ubiquitin-protein ligase RNF14-like... 82 2e-15 XP_009614469.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nic... 82 2e-15 XP_010677335.1 PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-prot... 82 2e-15 XP_019241496.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nic... 82 2e-15 XP_016472976.1 PREDICTED: E3 ubiquitin-protein ligase RNF14-like... 82 2e-15 XP_009802168.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nic... 82 2e-15 XP_019156436.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isof... 81 2e-15 XP_019156435.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isof... 81 2e-15 XP_019156434.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isof... 81 2e-15 OAY24363.1 hypothetical protein MANES_17G009500 [Manihot esculenta] 78 2e-15 XP_004244398.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Sol... 81 3e-15 XP_015085305.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Sol... 81 3e-15 XP_011082356.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Ses... 80 4e-15 CDP13066.1 unnamed protein product [Coffea canephora] 80 4e-15 XP_008346532.2 PREDICTED: E3 ubiquitin-protein ligase RNF14-like... 80 5e-15 >KVH95186.1 hypothetical protein Ccrd_002741 [Cynara cardunculus var. scolymus] Length = 94 Score = 77.0 bits (188), Expect = 5e-16 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQ+HYCYLC+K V+RSS HYGPK CKQHT G Sbjct: 59 IFCWACQSHYCYLCRKMVRRSSEHYGPKACKQHTLG 94 >KZM80577.1 hypothetical protein DCAR_032084 [Daucus carota subsp. sativus] Length = 550 Score = 82.8 bits (203), Expect = 6e-16 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWAC+NHYCYLCKK VKR SNHYGPKGCKQHT G Sbjct: 515 IFCWACRNHYCYLCKKIVKRGSNHYGPKGCKQHTEG 550 >XP_017228633.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Daucus carota subsp. sativus] Length = 625 Score = 82.8 bits (203), Expect = 6e-16 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWAC+NHYCYLCKK VKR SNHYGPKGCKQHT G Sbjct: 590 IFCWACRNHYCYLCKKIVKRGSNHYGPKGCKQHTEG 625 >KZM90934.1 hypothetical protein DCAR_021701 [Daucus carota subsp. sativus] Length = 373 Score = 81.6 bits (200), Expect = 1e-15 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWAC NHYCYLCKK VKR SNHYGPKGCKQHT G Sbjct: 338 IFCWACGNHYCYLCKKIVKRGSNHYGPKGCKQHTEG 373 >CDY53289.1 BnaA05g35990D [Brassica napus] Length = 49 Score = 75.1 bits (183), Expect = 1e-15 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 +FCWACQ H+CYLCKK VKR + HYGPKGCKQHT G Sbjct: 14 LFCWACQAHFCYLCKKVVKRCAQHYGPKGCKQHTDG 49 >XP_016454522.1 PREDICTED: E3 ubiquitin-protein ligase RNF14-like [Nicotiana tabacum] Length = 648 Score = 81.6 bits (200), Expect = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC+K VKRSS HYGPKGCKQHTA Sbjct: 613 IFCWACQNHYCYLCRKNVKRSSQHYGPKGCKQHTA 647 >XP_009614469.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nicotiana tomentosiformis] Length = 648 Score = 81.6 bits (200), Expect = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC+K VKRSS HYGPKGCKQHTA Sbjct: 613 IFCWACQNHYCYLCRKNVKRSSQHYGPKGCKQHTA 647 >XP_010677335.1 PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF14 [Beta vulgaris subsp. vulgaris] Length = 661 Score = 81.6 bits (200), Expect = 2e-15 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLC+KAV+RSS HYGPKGCKQH+ G Sbjct: 626 IFCWACQNHYCYLCRKAVRRSSEHYGPKGCKQHSEG 661 >XP_019241496.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nicotiana attenuata] OIT19414.1 putative e3 ubiquitin-protein ligase ari10 [Nicotiana attenuata] Length = 663 Score = 81.6 bits (200), Expect = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC+K VKRSS HYGPKGCKQHTA Sbjct: 628 IFCWACQNHYCYLCRKNVKRSSQHYGPKGCKQHTA 662 >XP_016472976.1 PREDICTED: E3 ubiquitin-protein ligase RNF14-like isoform X1 [Nicotiana tabacum] Length = 663 Score = 81.6 bits (200), Expect = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC+K VKRSS HYGPKGCKQHTA Sbjct: 628 IFCWACQNHYCYLCRKNVKRSSQHYGPKGCKQHTA 662 >XP_009802168.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Nicotiana sylvestris] Length = 663 Score = 81.6 bits (200), Expect = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC+K VKRSS HYGPKGCKQHTA Sbjct: 628 IFCWACQNHYCYLCRKNVKRSSQHYGPKGCKQHTA 662 >XP_019156436.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isoform X3 [Ipomoea nil] Length = 667 Score = 81.3 bits (199), Expect = 2e-15 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLCKK V+RSS H+GPKGCKQHT G Sbjct: 632 IFCWACQNHYCYLCKKMVRRSSQHFGPKGCKQHTVG 667 >XP_019156435.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isoform X2 [Ipomoea nil] Length = 681 Score = 81.3 bits (199), Expect = 2e-15 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLCKK V+RSS H+GPKGCKQHT G Sbjct: 646 IFCWACQNHYCYLCKKMVRRSSQHFGPKGCKQHTVG 681 >XP_019156434.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 isoform X1 [Ipomoea nil] Length = 691 Score = 81.3 bits (199), Expect = 2e-15 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLCKK V+RSS H+GPKGCKQHT G Sbjct: 656 IFCWACQNHYCYLCKKMVRRSSQHFGPKGCKQHTVG 691 >OAY24363.1 hypothetical protein MANES_17G009500 [Manihot esculenta] Length = 203 Score = 78.2 bits (191), Expect = 2e-15 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHT 102 IFCWACQ HYCYLCKK V+RSS HYGPKGCKQHT Sbjct: 168 IFCWACQKHYCYLCKKIVRRSSQHYGPKGCKQHT 201 >XP_004244398.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Solanum lycopersicum] Length = 678 Score = 80.9 bits (198), Expect = 3e-15 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC K VKRSS HYGPKGCKQHTA Sbjct: 642 IFCWACQNHYCYLCGKTVKRSSQHYGPKGCKQHTA 676 >XP_015085305.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Solanum pennellii] Length = 706 Score = 80.9 bits (198), Expect = 3e-15 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTA 105 IFCWACQNHYCYLC K VKRSS HYGPKGCKQHTA Sbjct: 670 IFCWACQNHYCYLCGKTVKRSSQHYGPKGCKQHTA 704 >XP_011082356.1 PREDICTED: E3 ubiquitin-protein ligase RNF14 [Sesamum indicum] Length = 676 Score = 80.5 bits (197), Expect = 4e-15 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLC+K V+RS+ HYGPKGCKQHT G Sbjct: 641 IFCWACQNHYCYLCRKMVRRSTQHYGPKGCKQHTVG 676 >CDP13066.1 unnamed protein product [Coffea canephora] Length = 679 Score = 80.5 bits (197), Expect = 4e-15 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 IFCWACQNHYCYLC+K V+RS+ HYGPKGCKQHT G Sbjct: 644 IFCWACQNHYCYLCRKMVRRSAQHYGPKGCKQHTVG 679 >XP_008346532.2 PREDICTED: E3 ubiquitin-protein ligase RNF14-like isoform X2 [Malus domestica] Length = 489 Score = 80.1 bits (196), Expect = 5e-15 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 IFCWACQNHYCYLCKKAVKRSSNHYGPKGCKQHTAG 108 +FCWACQNHYCYLCKK V+R S+HYGPKGCKQHT G Sbjct: 454 MFCWACQNHYCYLCKKMVRRGSHHYGPKGCKQHTQG 489