BLASTX nr result
ID: Panax25_contig00017239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017239 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012090191.1 PREDICTED: uncharacterized protein LOC105648425 [... 75 1e-13 XP_012858378.1 PREDICTED: desumoylating isopeptidase 2-like [Ery... 74 2e-13 XP_008234843.1 PREDICTED: deSI-like protein At4g17486 [Prunus mume] 74 3e-13 XP_007221005.1 hypothetical protein PRUPE_ppa010466mg [Prunus pe... 74 3e-13 XP_011084455.1 PREDICTED: deSI-like protein At4g17486 [Sesamum i... 72 1e-12 GAV76301.1 DUF862 domain-containing protein [Cephalotus follicul... 72 2e-12 XP_009368740.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x b... 72 2e-12 XP_008376635.1 PREDICTED: deSI-like protein At4g17486 [Malus dom... 71 3e-12 XP_009377608.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x b... 70 9e-12 XP_009375518.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x b... 70 9e-12 GAV75710.1 hypothetical protein CFOL_v3_19187, partial [Cephalot... 68 9e-12 XP_016702689.1 PREDICTED: uncharacterized protein LOC107917845 [... 70 2e-11 XP_012474551.1 PREDICTED: uncharacterized protein LOC105791156 [... 70 2e-11 XP_007038799.2 PREDICTED: uncharacterized protein LOC18605624 [T... 70 2e-11 EOY23298.1 PPPDE thiol peptidase family protein, putative isofor... 70 2e-11 XP_011076114.1 PREDICTED: uncharacterized protein LOC105160441 i... 69 2e-11 KJB23839.1 hypothetical protein B456_004G117500 [Gossypium raimo... 70 2e-11 XP_011076113.1 PREDICTED: uncharacterized protein LOC105160441 i... 69 2e-11 XP_017243381.1 PREDICTED: deSI-like protein At4g17486 [Daucus ca... 69 3e-11 KZV43327.1 deSI-like protein [Dorcoceras hygrometricum] 67 1e-10 >XP_012090191.1 PREDICTED: uncharacterized protein LOC105648425 [Jatropha curcas] KDP22234.1 hypothetical protein JCGZ_26065 [Jatropha curcas] Length = 260 Score = 75.5 bits (184), Expect = 1e-13 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAPRGQ 199 PGNSNRG+PRFQ AWFKNL+++G KPS S++++ QDEDVLL+Q+ ++ P Q Sbjct: 188 PGNSNRGTPRFQAAWFKNLITSGAKPSSSTDVDHQDEDVLLRQQHDQSDLPSRQ 241 >XP_012858378.1 PREDICTED: desumoylating isopeptidase 2-like [Erythranthe guttata] EYU19578.1 hypothetical protein MIMGU_mgv1a012735mg [Erythranthe guttata] Length = 241 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHD 178 PGNS RGSPRFQ +WFKNL+SAG KPSGSSELE DE++L QQ+R + Sbjct: 189 PGNSTRGSPRFQGSWFKNLISAGAKPSGSSELENGDEEMLRQQQRRE 235 >XP_008234843.1 PREDICTED: deSI-like protein At4g17486 [Prunus mume] Length = 249 Score = 73.9 bits (180), Expect = 3e-13 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAPRGQR 202 PGNS RG+PRFQ AWFKNL++ G KPS S+E+E ++EDVL ++ DAE+P Q+ Sbjct: 188 PGNSTRGTPRFQAAWFKNLITTGAKPSSSTEIENKEEDVLRHHQQSDAESPPRQK 242 >XP_007221005.1 hypothetical protein PRUPE_ppa010466mg [Prunus persica] ONI25396.1 hypothetical protein PRUPE_2G300300 [Prunus persica] Length = 249 Score = 73.9 bits (180), Expect = 3e-13 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAPRGQR 202 PGNS RG+PRFQ AWFKNL++ G KPS S+E+E ++EDVL ++ DAE+P Q+ Sbjct: 188 PGNSTRGTPRFQAAWFKNLITTGAKPSSSTEIENKEEDVLRHHQQSDAESPPRQK 242 >XP_011084455.1 PREDICTED: deSI-like protein At4g17486 [Sesamum indicum] Length = 248 Score = 72.4 bits (176), Expect = 1e-12 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAP 190 PGNS RGSPRFQT WFKNL+S G KPS SSE E ++++ QQ+R D EAP Sbjct: 189 PGNSTRGSPRFQTTWFKNLISNGAKPSNSSETENKNDEAAHQQQRQDDEAP 239 >GAV76301.1 DUF862 domain-containing protein [Cephalotus follicularis] Length = 261 Score = 72.0 bits (175), Expect = 2e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 PG SNRG+PRFQ+ WFKNL+++G KPS SSELE QDEDVL Q+ + D+E Sbjct: 189 PGISNRGTPRFQSTWFKNLITSGAKPSTSSELENQDEDVLGQKGKQDSE 237 >XP_009368740.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri] Length = 249 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 41 GNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAPRGQ 199 GNSNRG+PRFQ AWFKNL++ G KPS SS+LE ++ED L ++ DAE P Q Sbjct: 189 GNSNRGAPRFQAAWFKNLITTGAKPSSSSDLETKEEDALRPHQQPDAEPPLQQ 241 >XP_008376635.1 PREDICTED: deSI-like protein At4g17486 [Malus domestica] Length = 249 Score = 71.2 bits (173), Expect = 3e-12 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 41 GNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 GNSNRG+PRFQ AWFKNL++ G KPS SS+LE ++ED L Q ++ DAE Sbjct: 189 GNSNRGAPRFQAAWFKNLITTGAKPSSSSDLETKEEDALRQHQQPDAE 236 >XP_009377608.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri] Length = 249 Score = 70.1 bits (170), Expect = 9e-12 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAP 190 P NS+RG+PRFQ AWFKNL++ G KPS SS+ E ++EDVL Q ++ DAE P Sbjct: 188 PENSDRGTPRFQAAWFKNLITTGAKPSSSSDFENKEEDVLRQNQQPDAEPP 238 >XP_009375518.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri] XP_009377548.1 PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri] Length = 249 Score = 70.1 bits (170), Expect = 9e-12 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAEAP 190 P NS+RG+PRFQ AWFKNL++ G KPS SS+ E ++EDVL Q ++ DAE P Sbjct: 188 PENSDRGTPRFQAAWFKNLITTGAKPSSSSDFENKEEDVLRQNQQPDAEPP 238 >GAV75710.1 hypothetical protein CFOL_v3_19187, partial [Cephalotus follicularis] Length = 134 Score = 67.8 bits (164), Expect = 9e-12 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 PG SN G+PRFQ WFKNL+++G KPS SSELE QD+DVL+ + + D+E Sbjct: 63 PGISNTGTPRFQATWFKNLITSGSKPSTSSELENQDKDVLVHKGKQDSE 111 >XP_016702689.1 PREDICTED: uncharacterized protein LOC107917845 [Gossypium hirsutum] Length = 267 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 44 NSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQ-QRRHDA 181 NSN GSPRFQ+AWFKNLV+AG KPS SSE+E Q+ DV+LQ QR+H++ Sbjct: 190 NSNSGSPRFQSAWFKNLVTAGAKPSNSSEIETQEGDVVLQHQRQHNS 236 >XP_012474551.1 PREDICTED: uncharacterized protein LOC105791156 [Gossypium raimondii] KJB23840.1 hypothetical protein B456_004G117500 [Gossypium raimondii] Length = 267 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 44 NSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQ-QRRHDA 181 NSN GSPRFQ+AWFKNLV+AG KPS SSE+E Q+ DV+LQ QR+H++ Sbjct: 190 NSNSGSPRFQSAWFKNLVTAGAKPSNSSEIETQEGDVVLQHQRQHNS 236 >XP_007038799.2 PREDICTED: uncharacterized protein LOC18605624 [Theobroma cacao] XP_007038798.2 PREDICTED: uncharacterized protein LOC18605624 [Theobroma cacao] Length = 280 Score = 69.7 bits (169), Expect = 2e-11 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDA 181 PGNSNRG+PRFQ AWFKNL++ G KPS SSE+E QD ++L Q ++ ++ Sbjct: 188 PGNSNRGTPRFQAAWFKNLITTGAKPSSSSEIETQDGNILQQHQQQNS 235 >EOY23298.1 PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma cacao] EOY23299.1 PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma cacao] EOY23300.1 PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma cacao] Length = 280 Score = 69.7 bits (169), Expect = 2e-11 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDA 181 PGNSNRG+PRFQ AWFKNL++ G KPS SSE+E QD ++L Q ++ ++ Sbjct: 188 PGNSNRGTPRFQAAWFKNLITTGAKPSSSSEIETQDGNILQQHQQQNS 235 >XP_011076114.1 PREDICTED: uncharacterized protein LOC105160441 isoform X2 [Sesamum indicum] Length = 249 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 PGNSN GSPRFQ W KNLVS G KPS S++E QD+DV+ Q++R DAE Sbjct: 189 PGNSNSGSPRFQATWLKNLVSPGTKPSTGSKVENQDQDVVGQKQRRDAE 237 >KJB23839.1 hypothetical protein B456_004G117500 [Gossypium raimondii] Length = 282 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 44 NSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQ-QRRHDA 181 NSN GSPRFQ+AWFKNLV+AG KPS SSE+E Q+ DV+LQ QR+H++ Sbjct: 205 NSNSGSPRFQSAWFKNLVTAGAKPSNSSEIETQEGDVVLQHQRQHNS 251 >XP_011076113.1 PREDICTED: uncharacterized protein LOC105160441 isoform X1 [Sesamum indicum] Length = 274 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 PGNSN GSPRFQ W KNLVS G KPS S++E QD+DV+ Q++R DAE Sbjct: 189 PGNSNSGSPRFQATWLKNLVSPGTKPSTGSKVENQDQDVVGQKQRQDAE 237 >XP_017243381.1 PREDICTED: deSI-like protein At4g17486 [Daucus carota subsp. sativus] KZN00638.1 hypothetical protein DCAR_009392 [Daucus carota subsp. sativus] Length = 233 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRR 172 PG SNRG PRFQ WFKNLVS+GPKP+ SSE+EV+ D LLQQR+ Sbjct: 188 PGISNRGPPRFQATWFKNLVSSGPKPAESSEVEVRAGDSLLQQRQ 232 >KZV43327.1 deSI-like protein [Dorcoceras hygrometricum] Length = 239 Score = 67.0 bits (162), Expect = 1e-10 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +2 Query: 38 PGNSNRGSPRFQTAWFKNLVSAGPKPSGSSELEVQDEDVLLQQRRHDAE 184 PG+S RGSP+FQT+WFKNL+ +G KPS S EL+ DED Q++R D E Sbjct: 189 PGDSTRGSPKFQTSWFKNLIPSGAKPSSSLELDNMDEDATRQKQRQDVE 237