BLASTX nr result
ID: Panax25_contig00017195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017195 (520 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO83735.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] 71 2e-11 XP_006473057.1 PREDICTED: tubby-like F-box protein 8 [Citrus sin... 71 2e-11 XP_006434458.1 hypothetical protein CICLE_v10001251mg [Citrus cl... 71 2e-11 KVI10964.1 F-box domain, cyclin-like protein [Cynara cardunculus... 68 2e-10 AFK44234.1 unknown [Medicago truncatula] 67 4e-10 XP_015886435.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus j... 67 5e-10 XP_009351377.1 PREDICTED: tubby-like F-box protein 8 [Pyrus x br... 67 5e-10 XP_008381822.1 PREDICTED: tubby-like F-box protein 8 [Malus dome... 67 5e-10 XP_008237579.1 PREDICTED: tubby-like F-box protein 8 [Prunus mume] 67 5e-10 XP_007201025.1 hypothetical protein PRUPE_ppa006121mg [Prunus pe... 67 5e-10 NP_001280941.1 tubby-like F-box protein 8 [Malus domestica] ADL3... 67 5e-10 XP_003593111.1 tubby-F-box-like protein [Medicago truncatula] AE... 67 5e-10 XP_004290516.1 PREDICTED: tubby-like F-box protein 8 [Fragaria v... 67 5e-10 KVI01790.1 F-box domain, cyclin-like protein [Cynara cardunculus... 67 9e-10 CAN82256.1 hypothetical protein VITISV_009404 [Vitis vinifera] 66 1e-09 XP_011044216.1 PREDICTED: tubby-like F-box protein 8 isoform X2 ... 66 1e-09 XP_002306697.1 hypothetical protein POPTR_0005s21450g [Populus t... 66 1e-09 XP_012080754.1 PREDICTED: tubby-like F-box protein 8 [Jatropha c... 66 1e-09 XP_002267914.1 PREDICTED: tubby-like F-box protein 8 [Vitis vini... 66 1e-09 XP_011044215.1 PREDICTED: tubby-like F-box protein 8 isoform X1 ... 66 1e-09 >KDO83735.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] Length = 396 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH RGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKS 35 >XP_006473057.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] XP_006473058.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] XP_015384310.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] KDO83731.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83732.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83733.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83734.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] Length = 426 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH RGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKS 35 >XP_006434458.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] XP_006434459.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] ESR47698.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] ESR47699.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] Length = 426 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH RGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKS 35 >KVI10964.1 F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 381 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSF+VRL GHH+RGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLSGHHNRGKS 35 >AFK44234.1 unknown [Medicago truncatula] Length = 366 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRD FGSLSRRSF+V+L GHHHRGKS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVKLTGHHHRGKS 35 >XP_015886435.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus jujuba] XP_015886436.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus jujuba] Length = 425 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_009351377.1 PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri] Length = 426 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_008381822.1 PREDICTED: tubby-like F-box protein 8 [Malus domestica] Length = 426 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_008237579.1 PREDICTED: tubby-like F-box protein 8 [Prunus mume] Length = 426 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_007201025.1 hypothetical protein PRUPE_ppa006121mg [Prunus persica] ONH90002.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90003.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90004.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90005.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90006.1 hypothetical protein PRUPE_8G029200 [Prunus persica] Length = 426 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >NP_001280941.1 tubby-like F-box protein 8 [Malus domestica] ADL36842.1 TLP domain class transcription factor [Malus domestica] Length = 426 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_003593111.1 tubby-F-box-like protein [Medicago truncatula] AES63362.1 tubby-F-box-like protein [Medicago truncatula] Length = 427 Score = 67.4 bits (163), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRD FGSLSRRSF+V+L GHHHRGKS Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVKLTGHHHRGKS 35 >XP_004290516.1 PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] XP_011458506.1 PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] Length = 429 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPG-HHRGKS 34 >KVI01790.1 F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 412 Score = 66.6 bits (161), Expect = 9e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRR F+VRL GHH+RGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRGFDVRLSGHHNRGKS 35 >CAN82256.1 hypothetical protein VITISV_009404 [Vitis vinifera] Length = 380 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSF+VRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPG-HHRGKS 34 >XP_011044216.1 PREDICTED: tubby-like F-box protein 8 isoform X2 [Populus euphratica] Length = 423 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRD+RDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_002306697.1 hypothetical protein POPTR_0005s21450g [Populus trichocarpa] EEE93693.1 hypothetical protein POPTR_0005s21450g [Populus trichocarpa] Length = 423 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRD+RDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPG-HHRGKS 34 >XP_012080754.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080755.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080756.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080757.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080758.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080759.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] KDP30771.1 hypothetical protein JCGZ_15200 [Jatropha curcas] Length = 424 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSFE+RLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFELRLPG-HHRGKS 34 >XP_002267914.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665127.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665128.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665129.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_019072257.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_019072258.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] Length = 425 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRDVRDGFGSLSRRSF+VRLPG HHRGKS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPG-HHRGKS 34 >XP_011044215.1 PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica] Length = 431 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 107 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHHRGKS 3 MSFRSIVRD+RDGFGSLSRRSFEVRLPG HHRGKS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPG-HHRGKS 34