BLASTX nr result
ID: Panax25_contig00017133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017133 (542 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016511699.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 1e-13 XP_016458238.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 2e-13 KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp... 77 3e-13 XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 3e-13 XP_009626110.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 3e-13 XP_009792531.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 3e-13 XP_009626103.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 3e-13 ONM23841.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 5e-13 ONM23832.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23827.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23852.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23825.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23831.1 Regulator of nonsense transcripts 1-like protein, par... 76 6e-13 ONM23849.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23847.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 BAF21612.1 Os07g0495900, partial [Oryza sativa Japonica Group] B... 76 6e-13 ONM23866.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23868.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23838.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 ONM23842.1 Regulator of nonsense transcripts 1-like protein [Zea... 76 6e-13 >XP_016511699.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana tabacum] Length = 352 Score = 77.4 bits (189), Expect = 1e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 200 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 240 >XP_016458238.1 PREDICTED: regulator of nonsense transcripts 1 homolog, partial [Nicotiana tabacum] Length = 578 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 200 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 240 >KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp. sativus] Length = 1221 Score = 77.4 bits (189), Expect = 3e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 177 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 217 >XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1248 Score = 77.4 bits (189), Expect = 3e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 177 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 217 >XP_009626110.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X2 [Nicotiana tomentosiformis] Length = 1269 Score = 77.4 bits (189), Expect = 3e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 200 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 240 >XP_009792531.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana sylvestris] Length = 1272 Score = 77.4 bits (189), Expect = 3e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 200 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 240 >XP_009626103.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X1 [Nicotiana tomentosiformis] Length = 1273 Score = 77.4 bits (189), Expect = 3e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAESVVVLLCREPCLSVN L Sbjct: 200 TILECYNCGCRNVFLLGFISAKAESVVVLLCREPCLSVNAL 240 >ONM23841.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 493 Score = 76.3 bits (186), Expect = 5e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23832.1 Regulator of nonsense transcripts 1-like protein [Zea mays] ONM23850.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 638 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23827.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 832 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23852.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 865 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23825.1 Regulator of nonsense transcripts 1-like protein [Zea mays] ONM23835.1 Regulator of nonsense transcripts 1-like protein [Zea mays] ONM23851.1 Regulator of nonsense transcripts 1-like protein [Zea mays] ONM23853.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 895 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23831.1 Regulator of nonsense transcripts 1-like protein, partial [Zea mays] Length = 953 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23849.1 Regulator of nonsense transcripts 1-like protein [Zea mays] ONM23864.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1008 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23847.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1009 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >BAF21612.1 Os07g0495900, partial [Oryza sativa Japonica Group] BAT01595.1 Os07g0495900, partial [Oryza sativa Japonica Group] Length = 1121 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 66 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 106 >ONM23866.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1123 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23868.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1124 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23838.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1126 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 216 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 256 >ONM23842.1 Regulator of nonsense transcripts 1-like protein [Zea mays] Length = 1126 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 187 SIKECYNYGCRNIFLLGFISAKAESVVVLLCREPCLSVNEL 65 +I ECYN GCRN+FLLGFISAKAE+VVVLLCREPCLSVN L Sbjct: 68 TILECYNCGCRNVFLLGFISAKAENVVVLLCREPCLSVNAL 108