BLASTX nr result
ID: Panax25_contig00017055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00017055 (773 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84252.1 hypothetical protein DCAR_028454 [Daucus carota subsp... 69 2e-09 XP_017223651.1 PREDICTED: condensin complex subunit 3 [Daucus ca... 69 2e-09 XP_016696742.1 PREDICTED: condensin complex subunit 3-like [Goss... 59 4e-06 XP_012491386.1 PREDICTED: condensin complex subunit 3 [Gossypium... 59 4e-06 >KZM84252.1 hypothetical protein DCAR_028454 [Daucus carota subsp. sativus] Length = 1027 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -2 Query: 688 EGFATILLLSEKYPTIPASSHPLLFEKLMNRGFCSESTEL*R---CIVLF 548 EGFA ILLLS+KYPTIPASSHPLL EKLM FCSE TEL R C+ +F Sbjct: 687 EGFAKILLLSDKYPTIPASSHPLLLEKLMGLYFCSEITELRRLKQCLFVF 736 >XP_017223651.1 PREDICTED: condensin complex subunit 3 [Daucus carota subsp. sativus] Length = 1042 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -2 Query: 688 EGFATILLLSEKYPTIPASSHPLLFEKLMNRGFCSESTEL*R---CIVLF 548 EGFA ILLLS+KYPTIPASSHPLL EKLM FCSE TEL R C+ +F Sbjct: 687 EGFAKILLLSDKYPTIPASSHPLLLEKLMGLYFCSEITELRRLKQCLFVF 736 >XP_016696742.1 PREDICTED: condensin complex subunit 3-like [Gossypium hirsutum] Length = 1043 Score = 58.5 bits (140), Expect = 4e-06 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 688 EGFATILLLSEKYPTIPASSHPLLFEKLMNRGFCSESTEL*R---CIVLF 548 EGFA ILLLSEKYP+IPASSHPLL KL++ F +ES +L R C+ +F Sbjct: 688 EGFAKILLLSEKYPSIPASSHPLLLSKLISLYFSNESKDLQRLKQCLSVF 737 >XP_012491386.1 PREDICTED: condensin complex subunit 3 [Gossypium raimondii] KJB43166.1 hypothetical protein B456_007G187500 [Gossypium raimondii] Length = 1043 Score = 58.5 bits (140), Expect = 4e-06 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 688 EGFATILLLSEKYPTIPASSHPLLFEKLMNRGFCSESTEL*R---CIVLF 548 EGFA ILLLSEKYP+IPASSHPLL KL++ F +ES +L R C+ +F Sbjct: 688 EGFAKILLLSEKYPSIPASSHPLLLSKLISLYFSNESKDLQRLKQCLSVF 737