BLASTX nr result
ID: Panax25_contig00016681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00016681 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247146.1 PREDICTED: epidermal growth factor receptor subst... 62 2e-08 XP_017247145.1 PREDICTED: epidermal growth factor receptor subst... 62 2e-08 XP_017247144.1 PREDICTED: epidermal growth factor receptor subst... 62 2e-08 OMO89044.1 hypothetical protein CCACVL1_08043 [Corchorus capsula... 50 4e-06 >XP_017247146.1 PREDICTED: epidermal growth factor receptor substrate 15-like 1 isoform X3 [Daucus carota subsp. sativus] Length = 1013 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 306 MAGQNQGGG-NVDLFDAYFRKADLDQDGRISGA 401 MAGQNQGGG NVDLFDAYFR+ADLD DGRISGA Sbjct: 1 MAGQNQGGGGNVDLFDAYFRRADLDHDGRISGA 33 >XP_017247145.1 PREDICTED: epidermal growth factor receptor substrate 15-like 1 isoform X2 [Daucus carota subsp. sativus] Length = 1013 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 306 MAGQNQGGG-NVDLFDAYFRKADLDQDGRISGA 401 MAGQNQGGG NVDLFDAYFR+ADLD DGRISGA Sbjct: 1 MAGQNQGGGGNVDLFDAYFRRADLDHDGRISGA 33 >XP_017247144.1 PREDICTED: epidermal growth factor receptor substrate 15-like 1 isoform X1 [Daucus carota subsp. sativus] Length = 1014 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 306 MAGQNQGGG-NVDLFDAYFRKADLDQDGRISGA 401 MAGQNQGGG NVDLFDAYFR+ADLD DGRISGA Sbjct: 1 MAGQNQGGGGNVDLFDAYFRRADLDHDGRISGA 33 >OMO89044.1 hypothetical protein CCACVL1_08043 [Corchorus capsularis] Length = 44 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +3 Query: 306 MAGQNQGGGNVDLFDAYFRKADLDQDGRISGA 401 MA QNQ N DLFDAYFRKADL+ DG+ISGA Sbjct: 1 MAAQNQIPSNTDLFDAYFRKADLEGDGQISGA 32