BLASTX nr result
ID: Panax25_contig00016529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00016529 (1049 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017220669.1 PREDICTED: protein FATTY ACID EXPORT 4, chloropla... 56 7e-06 >XP_017220669.1 PREDICTED: protein FATTY ACID EXPORT 4, chloroplastic [Daucus carota subsp. sativus] KZM84312.1 hypothetical protein DCAR_028394 [Daucus carota subsp. sativus] Length = 178 Score = 56.2 bits (134), Expect = 7e-06 Identities = 34/65 (52%), Positives = 37/65 (56%) Frame = -2 Query: 601 AYFLMQASGTKEIGEXXXXXXXXXXXSVFGIRLAATRKIMPAGPXXXXXXXXXXXXXXAY 422 AYFLMQA T+E+GE SVFGIRLAATRKI+PAGP AY Sbjct: 114 AYFLMQAHDTQELGEALAFGSALLFASVFGIRLAATRKIVPAGPLLALSLCALVLFLSAY 173 Query: 421 LQETV 407 LQ TV Sbjct: 174 LQGTV 178