BLASTX nr result
ID: Panax25_contig00016328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00016328 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252384.1 PREDICTED: translation initiation factor IF-2, ch... 65 6e-10 XP_019193404.1 PREDICTED: translation initiation factor IF-2, ch... 64 3e-09 KZM94316.1 hypothetical protein DCAR_017559 [Daucus carota subsp... 62 7e-09 XP_015081953.1 PREDICTED: translation initiation factor IF-2, ch... 59 1e-07 XP_006366769.1 PREDICTED: translation initiation factor IF-2, ch... 59 1e-07 XP_004243227.1 PREDICTED: translation initiation factor IF-2, ch... 59 1e-07 XP_019249551.1 PREDICTED: translation initiation factor IF-2, ch... 55 3e-06 XP_009790742.1 PREDICTED: translation initiation factor IF-2, ch... 55 3e-06 XP_009601340.1 PREDICTED: translation initiation factor IF-2, ch... 55 3e-06 >XP_017252384.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Daucus carota subsp. sativus] Length = 1030 Score = 65.5 bits (158), Expect = 6e-10 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -1 Query: 163 SITMASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 SI M S+ SLVSLGS C+CSS QFEG ++FGSFRKV VG+RWRY Sbjct: 4 SINMNSIASLVSLGSVCSCSSVQFEGSLSSVSRVSLSQSFGSFRKVKVGRRWRY 57 >XP_019193404.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Ipomoea nil] Length = 1020 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 MAS+TSLV+LGS C+CSSGQFEG +NF SFR++ VGKRW Y Sbjct: 1 MASMTSLVNLGSVCSCSSGQFEGSSGLVGSISFAKNFRSFRRIWVGKRWPY 51 >KZM94316.1 hypothetical protein DCAR_017559 [Daucus carota subsp. sativus] Length = 1024 Score = 62.4 bits (150), Expect = 7e-09 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M S+ SLVSLGS C+CSS QFEG ++FGSFRKV VG+RWRY Sbjct: 1 MNSIASLVSLGSVCSCSSVQFEGSLSSVSRVSLSQSFGSFRKVKVGRRWRY 51 >XP_015081953.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum pennellii] Length = 1010 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M+S+ SLVSLGS C CSSGQFEG +NFGS ++ GKRWRY Sbjct: 1 MSSMASLVSLGSVCGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_006366769.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum tuberosum] Length = 1010 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M+S+ SLVSLGS C CSSGQFEG +NFGS ++ GKRWRY Sbjct: 1 MSSMASLVSLGSVCGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_004243227.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum lycopersicum] Length = 1010 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSGQFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M+S+ SLVSLGS C CSSGQFEG +NFGS ++ GKRWRY Sbjct: 1 MSSMASLVSLGSVCGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_019249551.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana attenuata] OIT00266.1 translation initiation factor if-2, chloroplastic [Nicotiana attenuata] Length = 1011 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSG-QFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M S+ SLVSLGS C CSSG QFEG NF +F ++ VGKRWRY Sbjct: 1 MTSMASLVSLGSVCGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52 >XP_009790742.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana sylvestris] XP_016514188.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Nicotiana tabacum] Length = 1013 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSG-QFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M S+ SLVSLGS C CSSG QFEG NF +F ++ VGKRWRY Sbjct: 1 MTSMASLVSLGSVCGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52 >XP_009601340.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana tomentosiformis] XP_016456731.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Nicotiana tabacum] Length = 1013 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 154 MASLTSLVSLGSTCTCSSG-QFEGXXXXXXXXXXXRNFGSFRKVSVGKRWRY 2 M S+ SLVSLGS C CSSG QFEG NF +F ++ VGKRWRY Sbjct: 1 MTSMASLVSLGSVCGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52