BLASTX nr result
ID: Panax25_contig00016282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00016282 (458 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015893477.1 PREDICTED: F-box/LRR-repeat protein 4 [Ziziphus j... 62 2e-08 XP_008221080.1 PREDICTED: F-box/LRR-repeat protein 4 [Prunus mume] 61 4e-08 XP_007222700.1 hypothetical protein PRUPE_ppa006391mg [Prunus pe... 61 4e-08 XP_012842081.1 PREDICTED: F-box/LRR-repeat protein 4 [Erythranth... 60 7e-08 XP_019186824.1 PREDICTED: F-box/LRR-repeat protein 20 [Ipomoea nil] 60 7e-08 XP_008445892.1 PREDICTED: F-box protein At3g58530 [Cucumis melo] 60 1e-07 XP_018817356.1 PREDICTED: F-box/LRR-repeat protein 2 [Juglans re... 59 2e-07 XP_009778014.1 PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana ... 59 2e-07 XP_009592242.1 PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana ... 59 2e-07 XP_008366959.1 PREDICTED: F-box/LRR-repeat protein 4-like isofor... 59 2e-07 XP_008366958.1 PREDICTED: F-box/LRR-repeat protein 20-like isofo... 59 2e-07 KVH95789.1 hypothetical protein Ccrd_002098 [Cynara cardunculus ... 58 6e-07 XP_019242927.1 PREDICTED: F-box/LRR-repeat protein 20 [Nicotiana... 58 6e-07 XP_016453096.1 PREDICTED: F-box/LRR-repeat protein 2-like [Nicot... 58 6e-07 XP_015942081.1 PREDICTED: F-box/LRR-repeat protein 4 [Arachis du... 58 6e-07 XP_016174413.1 PREDICTED: F-box/LRR-repeat protein 20 [Arachis i... 58 6e-07 XP_004236856.1 PREDICTED: F-box/LRR-repeat protein 2 [Solanum ly... 58 6e-07 XP_004147107.1 PREDICTED: F-box/LRR-repeat protein 2 [Cucumis sa... 58 6e-07 OMO62366.1 Leucine-rich repeat, cysteine-containing subtype [Cor... 57 8e-07 XP_004497244.1 PREDICTED: F-box/LRR-repeat protein 20 [Cicer ari... 57 1e-06 >XP_015893477.1 PREDICTED: F-box/LRR-repeat protein 4 [Ziziphus jujuba] Length = 414 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LLGALS+NCH LE+LGLQGCTNITD+GL Sbjct: 170 FVTDELLGALSKNCHKLEQLGLQGCTNITDAGL 202 >XP_008221080.1 PREDICTED: F-box/LRR-repeat protein 4 [Prunus mume] Length = 414 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL ALS+NCH LEELGLQGCTNITDSGL Sbjct: 170 FVTDGLLRALSKNCHYLEELGLQGCTNITDSGL 202 >XP_007222700.1 hypothetical protein PRUPE_ppa006391mg [Prunus persica] ONI32122.1 hypothetical protein PRUPE_1G349400 [Prunus persica] Length = 414 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL ALS+NCH LEELGLQGCTNITDSGL Sbjct: 170 FVTDGLLRALSKNCHYLEELGLQGCTNITDSGL 202 >XP_012842081.1 PREDICTED: F-box/LRR-repeat protein 4 [Erythranthe guttata] EYU33529.1 hypothetical protein MIMGU_mgv1a007230mg [Erythranthe guttata] Length = 414 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 ++TD+LL ALS NC+NLEELGLQGCTN+TDSGL Sbjct: 170 FITDSLLSALSMNCNNLEELGLQGCTNLTDSGL 202 >XP_019186824.1 PREDICTED: F-box/LRR-repeat protein 20 [Ipomoea nil] Length = 418 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+DALL ALS CHNLEELGLQGCTNITDSG+ Sbjct: 174 FVSDALLKALSEKCHNLEELGLQGCTNITDSGI 206 >XP_008445892.1 PREDICTED: F-box protein At3g58530 [Cucumis melo] Length = 421 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 98 VTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 VTD LL LS+NCHNLEELGL GCTNITDSGL Sbjct: 178 VTDGLLKTLSKNCHNLEELGLHGCTNITDSGL 209 >XP_018817356.1 PREDICTED: F-box/LRR-repeat protein 2 [Juglans regia] Length = 412 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 98 VTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 VTD LL ALS+NCHNLEELGLQGCTNI+D GL Sbjct: 164 VTDKLLHALSKNCHNLEELGLQGCTNISDPGL 195 >XP_009778014.1 PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana sylvestris] Length = 412 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+D+LL ALS+NCH+LEELGLQGCTNIT+SGL Sbjct: 168 FVSDSLLKALSKNCHSLEELGLQGCTNITNSGL 200 >XP_009592242.1 PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana tomentosiformis] XP_016436277.1 PREDICTED: F-box/LRR-repeat protein 2-like [Nicotiana tabacum] Length = 412 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+D+LL ALS+NCH+LEELGLQGCTNIT+SGL Sbjct: 168 FVSDSLLEALSKNCHSLEELGLQGCTNITNSGL 200 >XP_008366959.1 PREDICTED: F-box/LRR-repeat protein 4-like isoform X2 [Malus domestica] Length = 429 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL ALS+NC++LEELGLQGCTNITD+GL Sbjct: 171 FVTDGLLRALSKNCYHLEELGLQGCTNITDAGL 203 >XP_008366958.1 PREDICTED: F-box/LRR-repeat protein 20-like isoform X1 [Malus domestica] Length = 432 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL ALS+NC++LEELGLQGCTNITD+GL Sbjct: 174 FVTDGLLRALSKNCYHLEELGLQGCTNITDAGL 206 >KVH95789.1 hypothetical protein Ccrd_002098 [Cynara cardunculus var. scolymus] Length = 410 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL +LS+NCHNLEELGLQGC +ITD+GL Sbjct: 167 FVTDVLLKSLSKNCHNLEELGLQGCIDITDTGL 199 >XP_019242927.1 PREDICTED: F-box/LRR-repeat protein 20 [Nicotiana attenuata] OIT04216.1 f-boxlrr-repeat protein 4 [Nicotiana attenuata] Length = 412 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+D+LL ALS+NCH+LEELGL+GCTNIT+SGL Sbjct: 168 FVSDSLLKALSKNCHSLEELGLRGCTNITNSGL 200 >XP_016453096.1 PREDICTED: F-box/LRR-repeat protein 2-like [Nicotiana tabacum] Length = 412 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+D+LL ALS+NCH LEELGLQGCTNIT+SGL Sbjct: 168 FVSDSLLKALSKNCHILEELGLQGCTNITNSGL 200 >XP_015942081.1 PREDICTED: F-box/LRR-repeat protein 4 [Arachis duranensis] Length = 413 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD +L ALS+NCHNLE+LGLQGCTNIT+ GL Sbjct: 169 FVTDGILEALSKNCHNLEKLGLQGCTNITNYGL 201 >XP_016174413.1 PREDICTED: F-box/LRR-repeat protein 20 [Arachis ipaensis] Length = 416 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD +L ALS+NCHNLE+LGLQGCTNIT+ GL Sbjct: 172 FVTDGILEALSKNCHNLEKLGLQGCTNITNYGL 204 >XP_004236856.1 PREDICTED: F-box/LRR-repeat protein 2 [Solanum lycopersicum] Length = 420 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +V+D+L+ ALS NCHN+EE+GLQGCTNIT+SGL Sbjct: 176 FVSDSLMKALSENCHNVEEIGLQGCTNITNSGL 208 >XP_004147107.1 PREDICTED: F-box/LRR-repeat protein 2 [Cucumis sativus] KGN51559.1 hypothetical protein Csa_5G577980 [Cucumis sativus] Length = 421 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 98 VTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 VTD LL LS+NCH+LEELGL GCTNITDSGL Sbjct: 178 VTDGLLKTLSKNCHSLEELGLHGCTNITDSGL 209 >OMO62366.1 Leucine-rich repeat, cysteine-containing subtype [Corchorus olitorius] Length = 409 Score = 57.4 bits (137), Expect = 8e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD LL LS+NC NLEELGLQGCTNITD+GL Sbjct: 168 FVTDGLLLTLSKNCKNLEELGLQGCTNITDTGL 200 >XP_004497244.1 PREDICTED: F-box/LRR-repeat protein 20 [Cicer arietinum] Length = 416 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 101 YVTDALLGALSRNCHNLEELGLQGCTNITDSGL 3 +VTD++L ALS NC NLEELGLQGCT+ITD+GL Sbjct: 172 FVTDSILKALSENCRNLEELGLQGCTSITDNGL 204